KEGG   Escherichia coli K-12 MG1655: b0241Help
Entry
b0241             CDS       T00007                                 

Gene name
phoE
Definition
(RefSeq) outer membrane phosphoporin protein E
  KO
K11929  
outer membrane pore protein E
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b0241 (phoE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(259045..260100)
Genome map
AA seq 351 aa AA seqDB search
MKKSTLALVVMGIVASASVQAAEIYNKDGNKLDVYGKVKAMHYMSDNASKDGDQSYIRFG
FKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKYKDLGSFDYGRNLGALY
DVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVIDGLNLTLQYQGKNENRD
VKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSRGTGKRAEAWATGLKYDAN
NIYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLRPSLGYVLSKGKDIEGIGDE
DLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINNDDIVAVGMTYQF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagcactctggcattagtggtgatgggcattgtggcatctgcatctgtacag
gctgcagaaatatataataaagacggtaataaactggatgtctatggcaaagttaaagcc
atgcattatatgagtgataacgccagtaaagatggcgaccagagttatatccgttttggt
ttcaaaggcgaaacacaaattaacgatcaactgactggttatggtcgttgggaagcagag
tttgccggtaataaagcagagagtgatactgcacagcaaaaaacgcgtctcgcttttgcc
gggttgaaatataaagatttgggttctttcgattatggtcgtaacctgggggcgttgtat
gacgtggaagcctggaccgatatgttcccggaatttggtggcgattcctcggcgcagacc
gacaactttatgaccaaacgcgccagcggtctggcgacgtatcggaacaccgacttcttc
ggcgttatcgatggcctgaacttaaccctgcaatatcaagggaaaaacgaaaaccgcgac
gttaaaaagcaaaacggcgatggcttcggcacgtcattgacatatgactttggcggcagc
gatttcgccattagtggggcctataccaactcagatcgcaccaacgagcagaacctgcaa
agccgtggcacaggcaagcgtgcagaagcatgggcaacaggtctgaaatacgatgccaat
aatatttatctggcaactttctattctgaaacacgcaaaatgacgccaataactggcggc
tttgccaataagacacagaactttgaagcggtcgctcaataccagtttgactttggtctg
cgtccatcgctgggttatgtcttatcgaaagggaaagatattgaaggtatcggtgatgaa
gatctggtcaattatatcgacgtcggtgctacgtattatttcaacaaaaatatgtcagcg
tttgttgattataaaatcaaccaactggatagcgataacaaattgaatattaataatgat
gatattgtcgcggttggcatgacgtatcagttttaa

DBGET integrated database retrieval system