KEGG   Escherichia coli K-12 MG1655: b0269Help
Entry
b0269             CDS       T00007                                 

Gene name
yagF
Definition
(RefSeq) CP4-6 prophage; dehydratase family protein
  KO
K22396  
xylonate dehydratase [EC:4.2.1.82]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    b0269 (yagF)
Enzymes [BR:eco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.82  xylonate dehydratase
     b0269 (yagF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
283201..285168
Genome map
AA seq 655 aa AA seqDB search
MTIEKIFTPQDDAFYAVITHAAGPQGALPLTPQMLMESPSGNLFGMTQNAGMGWDANKLT
GKEVLIIGTQGGIRAGDGRPIALGYHTGHWEIGMQMQAAAKEITRNGGIPFAAFVSDPCD
GRSQGTHGMFDSLPYRNDAAIVFRRLIRSLPTRRAVIGVATCDKGLPATMIALAAMHDLP
TILVPGGATLPPTVGEDAGKVQTIGARFANHELSLQEAAELGCRACASPGGGCQFLGTAG
TSQVVAEALGLALPHSALAPSGQAVWLEIARQSARAVSELDSRGITTRDILSDKAIENAM
VIHAAFGGSTNLLLHIPAIAHAAGCTIPDVEHWTRINRKVPRLVSVLPNGPDYHPTVRAF
LAGGVPEVMLHLRDLGLLHLDAMTVTGQTVGENLEWWQASERRARFRQCLREQDGVEPDD
VILPPEKAKAKGLTSTVCFPTGNIAPEGSVIKATAIDPSVVGEDGVYHHTGRVRVFVSEA
QAIKAIKREEIVQGDIMVVIGGGPSGTGMEETYQLTSALKHISWGKTVSLITDARFSGVS
TGACFGHVSPEALAGGPIGKLRDNDIIEIAVDRLTLTGSVNFIGTADNPLTPEEGARELA
RRQTHPDLHAHDFLPDDTRLWAALQSVSGGTWKGCIYDTDKIIEVINAGKKALGI
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgagaaaattttcaccccgcaggacgacgcgttttatgcggtgatcacccac
gcggcggggccgcagggcgctctgccgctgaccccgcagatgctgatggaatctcccagc
ggcaacctgttcggcatgacgcagaacgccgggatgggctgggacgccaacaagctcacc
ggcaaagaggtgctgattatcggcactcagggcggcatccgcgccggagacggacgccca
atcgcgctgggctaccacaccgggcattgggagatcggcatgcagatgcaggcggcggcg
aaggagatcacccgcaatggcgggatcccgttcgcggccttcgtcagcgatccgtgcgac
gggcgctcgcagggcacgcacggtatgttcgattccctgccgtaccgcaacgacgcggcg
atcgtgtttcgccgcctgatccgctccctgccgacgcggcgggcggtgatcggcgtagcg
acctgcgataaagggctgcccgccaccatgattgcgctggccgcgatgcacgacctgccg
actattctggtgccgggcggggcgacgctgccgccgaccgtcggggaagacgcgggcaag
gtgcagaccatcggcgcgcgtttcgccaaccacgaactctccctgcaggaggccgccgaa
ctgggctgtcgcgcctgcgcctcgccgggcggcgggtgtcagttcctcggcacggcgggc
acctcgcaggtggtcgcggaggcgctgggtctggcgctgccgcactccgcgctggcgccg
tccgggcaggcggtgtggctggagatcgcccgccagtcggcgcgcgcggtcagcgagctg
gatagccgcggcatcaccacgcgggatatcctctccgataaagccatcgaaaacgcgatg
gtgatccacgcggcgttcggcggctccaccaatttactgctgcacattccggccatcgcc
cacgcggcgggctgcacgatcccggacgttgagcactggacgcgcatcaaccgtaaagtg
ccgcgtctggtgagcgtgctgcccaacggcccggactatcacccgaccgtgcgcgccttc
ctcgcgggcggcgtgccggaggtgatgctccacctgcgcgacctcggcctgctgcatctg
gacgccatgaccgtgaccggccagacggtgggcgagaaccttgaatggtggcaggcgtcc
gagcgccgggcgcgcttccgccagtgcctgcgcgagcaggacggcgtagagccggatgac
gtgatcctgccgccggagaaggcaaaagcgaaagggctgacctcgacggtctgcttcccg
acgggcaacatcgctccggaaggttcggtgatcaaggccacggcgatcgacccgtcggtg
gtgggcgaagatggcgtataccaccacaccggccgggtgcgggtgtttgtctcggaagcg
caggcgatcaaggcgatcaagcgggaagagattgtgcagggcgatatcatggtggtgatc
ggcggcgggccgtccggcaccggcatggaagagacctaccagctcacctccgcgctaaag
catatctcgtggggcaagacggtgtcgctcatcaccgatgcgcgcttctcgggcgtgtcg
acgggcgcctgcttcggccacgtgtcgccggaggcgctggcgggcgggccgattggcaag
ctgcgcgataacgacatcatcgagattgccgtggatcgtctgacgttaactggcagcgtg
aacttcatcggcaccgcggacaacccgctgacgccggaagagggcgcgcgcgagctggcg
cggcggcagacgcacccggacctgcacgcccacgactttttgccggacgacacccggctg
tgggcggcactgcagtcggtgagcggcggcacctggaaaggctgtatttatgacaccgat
aaaattatcgaggtaattaacgccggtaaaaaagcgctcggaatttaa

DBGET integrated database retrieval system