KEGG   Escherichia coli K-12 MG1655: b0270Help
Entry
b0270             CDS       T00007                                 

Gene name
yagG
Definition
(RefSeq) CP4-6 prophage; putative sugar transporter
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
285395..286777
Genome map
AA seq 460 aa AA seqDB search
MTQLTMKDKIGYGLGDTACGFVWQATMFLLAYFYTDVFGLSAGIMGTLFLVSRVLDAVTD
PLMGLLVDRTRTRHGQFRPFLLWGAIPFGIVCVLTFYTPDFSAQGKIIYACVTYILLTLV
YTFVNVPYCAMPGVITADPKERHALQSWRFFLAAAGSLAISGIALPLVSIIGKGDEQVGY
FGAMCVLGLSGVVLLYVCFFTTKERYTFEVQPGSSVAKDLKLLLGNSQWRIMCAFKMMAT
CSNVVRGGATLYFVKYVMDHPELATQFLLYGSLATMFGSLCSSRLLGRFDRVTAFKWIIV
AYSLISLLIFVTPAEHIALIFALNILFLFVFNTTTPLQWLMASDVVDYEESRSGRRLDGL
VFSTYLFSLKIGLAIGGAVVGWILAYVNYSASSSVQPVEVLTTIKILFCVVPVVLYAGMF
IMLSLYKLTDARVEAISRQLIKHRAAQGEAVPDAATAASH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaattaaccatgaaagacaaaattggctacgggctgggagacaccgcctgcggc
ttcgtctggcaggccacgatgttcctgctggcctatttctacaccgacgtcttcggcctg
tcggcggggattatgggcacgctgtttttggtctcccgcgtgctcgacgccgtcaccgac
ccgctgatggggctgctggtagaccgcacccgcacgcggcacggccagttccgcccgttc
ctgctgtggggggccatcccgttcggcatcgtctgcgtgctgaccttctacacgccggac
ttctccgcacagggcaagatcatctacgcctgcgtgacctacattctcctgaccctggtc
tacaccttcgttaacgtgccgtactgcgccatgccgggcgtcatcaccgccgacccgaaa
gagcgtcacgccctgcagtcctggcgcttcttcctggcggcggcgggctcgctcgctatc
agcggcatcgcgctgccgctggtgagcatcatcggcaaaggggacgagcaggtgggctac
ttcggcgccatgtgcgtgctggggctgagcggcgtggtgctgctctacgtctgcttcttc
acgaccaaagagcgctacacctttgaggtgcagccgggctcgtcggtggcgaaagacctt
aagctgctgctgggcaacagccagtggcgcatcatgtgcgcgttcaagatgatggcgacc
tgctccaacgtggtgcgcggcggggcgacgctctacttcgtgaaatacgtgatggatcac
ccggagttggcgacccagtttttactttacggcagcctcgccaccatgttcggctcgctt
tgctcctcacgcctgctgggccgcttcgaccgcgtcaccgccttcaagtggatcatcgtc
gcctactcgctgatcagcctgctgattttcgtcaccccggcggagcacatcgcgctcatt
tttgccctcaacatcctgttcctgttcgtctttaataccaccacgccgctgcagtggctg
atggcttctgacgtggtggactacgaggagagccgcagcggtcgccgcctcgacgggctg
gtgttctccacctacctgttcagcctgaagattggcctggcgattggcggggcggtggtg
ggctggatcctggcgtacgtcaactattccgccagcagcagcgtgcagccggttgaggtg
ctcaccaccatcaaaattctgttctgcgtggtgccggtggtgctctacgcgggcatgttc
atcatgctgtcgctctacaagctcaccgatgcccgcgtggaggccatcagccggcagctg
attaagcaccgcgcggcgcagggcgaggccgttcccgacgccgcgacagccgcatcccat
taa

DBGET integrated database retrieval system