KEGG   Escherichia coli K-12 MG1655: b0273Help
Entry
b0273             CDS       T00007                                 

Gene name
argF
Definition
(RefSeq) ornithine carbamoyltransferase 2, chain F; CP4-6 prophage (EC:2.1.3.3)
  KO
K00611  
ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Arginine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    b0273 (argF)
  Amino acid metabolism
   00220 Arginine biosynthesis
    b0273 (argF)
Enzymes [BR:eco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     b0273 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(289301..290305)
Genome map
AA seq 334 aa AA seqDB search
MSDLYKKHFLKLLDFTPAQFTSLLTLAAQLKADKKNGKEVQKLTGKNIALIFEKDSTRTR
CSFEVAAFDQGARVTYLGPSGSQIGHKESIKDTARVLGRMYDGIQYRGHGQEVVETLAQY
AGVPVWNGLTNEFHPTQLLADLMTMQEHLPGKAFNEMTLVYAGDARNNMGNSMLEAAALT
GLDLRLLAPKACWPEESLVAECSALAEKHGGKITLTEDVAAGVKGADFIYTDVWVSMGEA
KEKWAERIALLRGYQVNAQMMALTDNPNVKFLHCLPAFHDDQTTLGKQMAKEFDLHGGME
VTDEVFESAASIVFDQAENRMHTIKAVMMATLGE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatttatacaaaaaacactttctgaaactgctcgactttacccctgcacagttc
acttctctgctgacccttgccgcacagctcaaagccgataaaaaaaatggcaaggaagta
cagaagcttaccggtaaaaacatcgcgctcatcttcgaaaaagactcgactcgtacccgt
tgctctttcgaagttgccgcatttgaccagggcgcgcgcgttacctatttagggccgagc
ggcagccagattgggcataaagagtcaattaaggacaccgcgcgggttctcgggcggatg
tatgacggcattcagtatcgcggtcacggccaggaagtggtcgaaacgctggcgcagtat
gcgggcgtgccggtgtggaacgggctgaccaacgagttccacccgacccagctgctggcg
gacctgatgaccatgcaggagcacctgccgggcaaggcgtttaacgagatgacgctggtc
tacgcgggcgatgcgcgcaacaacatgggcaactcgatgctggaagcggcggcgctgacc
gggctggatctgcgcctgttggccccgaaagcctgctggccggaagagagcctggtggcg
gagtgcagcgcgctggcggagaagcacggcgggaaaattactctgacggaagacgtggcg
gcaggcgttaagggcgcggactttatctataccgacgtgtgggtgtcgatgggcgaggcc
aaagagaagtgggcagagcggattgcgctgctgcgcgggtatcaggtgaacgcgcagatg
atggcgctgaccgacaacccgaacgtgaagttcctgcactgtctgccggcgttccatgac
gaccagactacgctcggcaagcagatggcgaaggagttcgatctgcacggcgggatggag
gtgacggacgaggtgtttgagtcggcggcgagcatcgtgttcgaccaggcggaaaaccgg
atgcatacgattaaggcggtgatgatggcaacgcttggggagtga

DBGET integrated database retrieval system