KEGG   Escherichia coli K-12 MG1655: b0288Help
Entry
b0288             CDS       T00007                                 

Gene name
ykgJ
Definition
(RefSeq) UPF0153 cysteine cluster protein
  KO
K06940  uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CxxCxxCC
Motif
Other DBs
NCBI-GeneID: 945905
NCBI-ProteinID: NP_414822
Pasteur: ykgJ
RegulonDB: ECK120002779
ECOCYC: G6159
ASAP: ABE-0000997
UniProt: P0AAL9
Position
complement(303853..304182)
Genome map
AA seq 109 aa AA seqDB search
MSNLNPCMTCGACCAFFRVSFYWAEADDAGGTIPARLTEQISPFHRCMSGTNQKNPRCIA
LAGTPGKNACCTIYKNRSSTCREFAMSGENGVVNEACNRARAKYGLTPL
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatctgaatccatgcatgacgtgtggtgcctgttgtgcatttttccgcgtctct
ttttactgggccgaagccgacgatgctggcggtactattcccgccaggctcactgaacaa
atatccccttttcaccgatgcatgagcggtaccaatcagaaaaacccccgatgtattgcc
cttgcaggaaccccgggcaaaaatgcctgctgcacgatatataaaaatcgatcgtccaca
tgcagagaattcgccatgtctggtgagaacggagtcgtcaatgaggcttgcaatcgtgca
agggctaaatacgggctgacaccgttataa

DBGET integrated database retrieval system