KEGG   Escherichia coli K-12 MG1655: b0291Help
Entry
b0291             CDS       T00007                                 

Gene name
ecpC
Definition
(RefSeq) ECP production outer membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ASAP: 
UniProt: 
Position
complement(306807..309332)
Genome map
AA seq 841 aa AA seqDB search
MPLRRFSPGLKAQFAFGMVFLFVQPDASAADISAQQIGGVIIPQAFSQALQDGMSVPLYI
HLAGSQGRQDDQRIGSAFIWLDDGQLRIRKIQLEESEDNASVSEQTRQQLMALANAPFNE
ALTIPLTDNAQLDLSLRQLLLQLVVKREALGTVLRSRSEDIGQSSVNTLSSNLSYNLGVY
NNQLRNGGSNTSSYLSLNNVTALREHHVVLDGSLYGIGSGQQDSELYKAMYERDFAGHRF
AGGMLDTWNLQSLGPMTAISAGKIYGLSWGNQASSTIFDSSQSATPVIAFLPAAGEVHLT
RDGRLLSVQNFTMGNHEVDTRGLPYGIYDVEVEVIVNGRVISKRTQRVNKLFSRGRGVGA
PLAWQVWGGSFHMDRWSENGKKTRPAKESWLAGASTSGSLSTLSWAATGYGYDNQAVGET
RLTLPLGGAINVNLQNMLASDSSWSSIGSISATLPGGFSSLWVNQEKTRIGNQLRRSDAD
NRAIGGTLNLNSLWSKLGTFSISYNDDRRYNSHYYTADYYQNVYSGTFGSLGLRAGIQRY
NNGDSNANTGKYIALDLSLPLGNWFSAGMTHQNGYTMANLSARKQFDEGTIRTVGANLSR
AISGDTGDDKTLSGGAYAQFDARYASGTLNVNSAADGYVNTNLTANGSVGWQGKNIAASG
RTDGNAGVIFNTGLEDDGQISAKINGRIFPLNGKRNYLPLSPYGRYEVELQNSKNSLDSY
DIVSGRKSRLTLYPGNVAVIEPEVKQMVTVSGRIRAEDGTLLANARINNHIGRTRTDENG
EFVMDVDKKYPTIDFRYSGNKTCEVALELNQARGAVWVGDVVCSGLSSWAAVTQTGEENE
S
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgcctttacgacggttctccccaggactgaaagcccagtttgccttcggcatggtcttt
ttgttcgttcagcccgatgccagcgctgctgacataagtgcgcagcaaataggtggggtg
attattccgcaggccttcagtcaggcgcttcaggacggcatgagcgtcccgctctatatt
catctcgccggtagccagggtcgccaggacgatcagcgaatcggcagcgcttttatctgg
ctggacgatggacagctacgcatccggaaaatacagctggaagagagtgaagataacgcc
agtgtcagcgaacaaactcgacagcagctgatggctctggccaacgccccgttcaatgag
gcccttaccatccccctgactgacaacgcgcagctggatctcagcttgcgccaactgctg
ctgcagctagtggtcaagcgcgaagcgctgggcaccgtactacgctcacgtagcgaagac
atcgggcagtccagtgttaacaccctcagcagtaatctgagctataacttgggcgtctat
aacaaccagttgcgtaacggcgggagcaacacatccagctatctgtcgctgaataacgtt
actgcactgcgcgaacatcatgtggtgctcgacggctcgctgtacgggatcggtagcggt
caacaggacagtgaattatataaagcgatgtatgaacgcgattttgccggtcaccgattt
gccggtggaatgctcgacacctggaacttgcagtccttagggccgatgaccgccatttca
gcagggaagatttacggcctttcctggggaaaccaggccagctccaccatcttcgacagc
agccagtcagccacgccagtgatcgcctttttaccggcggcgggcgaagtacatctcacc
cgtgatgggcggctactaagcgttcagaacttcactatgggcaatcatgaagtggatacc
cggggtctaccgtacgggatttacgatgtggaagttgaggtgatcgttaacggtcgcgtg
atcagcaaacgcacccagcgggtcaataagctgtttagccgggggcgcggcgtcggtgca
ccactggcgtggcaggtatggggcggtagctttcatatggatcgctggtcggaaaacggg
aaaaagacgcgaccagctaaagagagttggctagcaggtgcctcgacctccggctcattg
agtacgcttagctgggcggcaacgggatatggatacgataatcaggcggtgggtgaaacc
cgtctgacgctgccgcttgggggggcgatcaacgttaacctgcaaaatatgctggccagt
gacagctcatggagcagcatcggcagcatcagcgccactctaccgggaggctttagttcg
ctgtgggttaatcaggaaaaaacccgcattggcaatcaattgcgacgtagcgatgccgac
aaccgtgcaatcggcggcacactcaacctgaactcactgtggtcgaagctgggcacattc
agcatcagctacaatgatgaccgccgttacaacagccattattacacggcagattactat
caaaatgtctacagcggtacctttggttcgcttggcctgcgggccggtattcagcgctat
aacaacggcgacagcaacgccaatacaggaaaatatatcgctctcgatctctcgctacca
ctgggcaactggtttagcgcagggatgactcatcaaaacggctacaccatggcaaacctg
tcagcacgcaaacagtttgatgaaggaaccattcgcactgttggtgccaatctgtcacgt
gccatctccggcgataccggtgatgacaaaaccctcagcggcggggcgtatgcacaattc
gacgctcgttacgccagcggaacgctgaacgtcaatagcgcggcggacggctacgtcaat
accaacttgaccgccaatggcagcgtcggctggcagggtaaaaacattgctgccagcggg
cggactgatggcaacgctggggtgatattcaacaccgggctggaggacgacggtcagatc
agcgccaaaatcaacgggcggattttcccgcttaacggcaagcgtaactatctcccgctc
tctccctatggaagatatgaggtggagttacagaacagcaaaaactcactcgacagttac
gatatcgtcagcggccgcaaaagtcgtctgactctctatccaggcaatgtcgctgtcatt
gagccagaggtgaagcagatggttaccgtctccggtcgtatccgtgcggaagacggcaca
ctgctggctaacgcacggattaacaaccatatcggccgaacccgaaccgatgaaaacggc
gagtttgtcatggacgtggataagaaataccccactatcgattttcgctacagtggcaat
aaaacctgcgaagtggctctggaactcaaccaggcgcgcggtgccgtctgggtcggtgat
gtggtctgcagcggcctctcatcgtgggcggcggtgacgcagacaggagaagagaatgag
agttaa

DBGET integrated database retrieval system