KEGG   Escherichia coli K-12 MG1655: b0293Help
Entry
b0293             CDS       T00007                                 

Gene name
ecpA
Definition
(RefSeq) ECP pilin
  KO
K21964  
Mat/Ecp fimbriae major subunit
Organism
eco  Escherichia coli K-12 MG1655
Brite
Secretion system [BR:eco02044]
 Chaperone-usher system
  Mat/Ecp fimbriae assembly protein
   b0293 (ecpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(310084..310671)
Genome map
AA seq 195 aa AA seqDB search
MKKKVLAIALVTVFTGMGVAQAADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEG
IKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGSTLNVGVDYNGAAVEKTG
DTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGTTNGTTAVTDYSTLPEGI
WSGDVSVQFDATWTS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaggttctggcaatagctctggtaacggtgtttaccggcatgggtgtggcg
caggctgctgacgtaacagctcaggctgtagcgacctggtcggcaacagccaaaaaagac
accaccagtaagctggttgtgacgccactcggtagcctggcgttccagtatgccgaaggc
attaaaggttttaactcacagaaaggtctatttgacgtggctatcgagggtgactcaacg
gctaccgcctttaaactgacctcacgtcttatcaccaacacattaacccagttggatacc
tcaggttccacactgaatgtgggcgtggattataacggcgcggcagtcgaaaaaactggc
gataccgtgatgatcgataccgccaacggcgtactgggcggcaaccttagcccgctggct
aacggttacaatgccagcaatcgtaccaccgcacaggatggtttcaccttctccatcatc
agcggtaccaccaatggtaccaccgcagtaacagattacagcactctaccggaaggcatc
tggagcggcgacgttagcgtacagttcgacgcgacctggaccagttaa

DBGET integrated database retrieval system