KEGG   Escherichia coli K-12 MG1655: b0307Help
Entry
b0307             CDS       T00007                                 

Gene name
ykgF
Definition
(RefSeq) ferridoxin-like LutB family protein; putative electron transport chain YkgEFG component
  KO
K18929  
L-lactate dehydrogenase complex protein LldF
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
322338..323765
Genome map
AA seq 475 aa AA seqDB search
MSIKTSNTDFKTRIRQQIEDPIMRKAVANAQQRIGANRQKMVDELGHWEEWRDRAAQIRD
HVLSNLDAYLYQLSEKVTQNGGHVYFARTKEDATRYILQVAQRKNARKVVKSKSMVTEEI
GVNHVLQDAGIQVIETDLGEYILQLDQDPPSHVVVPAIHKDRHQIRRVLHERLGYEGPET
PEAMTLFIRQKIREDFLSAEIGITGCNFAVAETGSVCLVTNEGNARMCTTLPKTHIAVMG
MERIAPTFAEVDVLITMLARSAVGARLTGYNTWLTGPREAGHVDGPEEFHLVIVDNGRSE
VLASEFRDVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGPIGAVISPLLGGYKDFKDLPY
ACSLCTACDNVCPVRIPLSKLILRHRRVMAEKGITAKAEQRAIKMFAYANSHPGLWKVGM
MAGAHAASWFINGGKTPLKFGAISDWMEARDLPEADGESFRSWFKKHQAQEKKNG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcaaaaccagtaatacagattttaagacacgcatccgtcagcaaattgaagat
ccgatcatgcgcaaagcggtggcaaacgcgcagcagcgtattggggcaaatcggcaaaaa
atggtcgatgaattggggcactgggaggagtggcgcgatcgggccgcccagatacgtgat
catgttctgagtaatctcgacgcttatctgtaccagctctcagaaaaagtgacgcaaaac
ggcggtcacgtctattttgcaagaaccaaagaagacgctacccgctacattttacaggtt
gcccaacgcaaaaatgcccggaaggtggtgaaatctaaatcgatggtgaccgaagagatt
ggtgtcaatcatgtgttgcaggatgctggcattcaggtgattgaaaccgatctgggtgaa
tatattctccagctggatcaagatccgccatctcatgttgtggtcccggcaattcataaa
gatcgccatcagatccgtcgagtgctacacgaacgtctgggctatgaggggccggaaacg
cctgaagcgatgaccttattcatccggcaaaaaatccgcgaagatttcctcagtgctgaa
ataggtattaccggctgtaatttcgcggtggcagagaccggttcggtatgcctggtgacc
aatgaaggtaatgcgcgaatgtgtaccacgctgcctaaaacgcatattgcagtgatggga
atggagcgtattgcccccacgtttgccgaggtagatgtattgatcaccatgctggcgcgc
agtgccgttggtgcacgtttgacgggatacaacacctggctgacaggaccgcgcgaagct
gggcacgttgatggtcctgaagagtttcatctggttattgtcgataacgggcgttctgag
gtgctggcctctgaatttcgggatgtgctgcgctgtattcgctgcggggcttgtatgaat
acttgtccggcatatcgccatattggcggtcatggatatggctctatttatccagggcca
attggtgcggtgatttctccgctacttggcggctataaagattttaaagatttaccctac
gcctgctctttatgcacagcttgtgacaacgtgtgtccggtgcgtattccgctgtcaaaa
ctgattttgcgtcatcgtcgggtgatggctgaaaaagggatcaccgcaaaagcagagcaa
cgggcgataaaaatgttcgcttatgccaatagtcatccaggattgtggaaagtcgggatg
atggccggtgctcatgcggcaagctggtttatcaatggcggcaaaacaccactcaaattt
ggcgcgattagcgactggatggaagcacgcgatcttcctgaagctgacggagagagtttc
cgtagttggtttaagaaacatcaggcgcaggagaaaaagaatggataa

DBGET integrated database retrieval system