KEGG   Escherichia coli K-12 MG1655: b0328Help
Entry
b0328             CDS       T00007                                 

Gene name
yahN
Definition
(RefSeq) amino acid exporter for proline, lysine, glutamate, homoserine
  KO
K03329  
amino acid exporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b0328 (yahN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(345666..346337)
Genome map
AA seq 223 aa AA seqDB search
MMQLVHLFMDEITMDPLHAVYLTVGLFVITFFNPGANLFVVVQTSLASGRRAGVLTGLGV
ALGDAFYSGLGLFGLATLITQCEEIFSLIRIVGGAYLLWFAWCSMRRQSTPQMSTLQQPI
SAPWYVFFRRGLITDLSNPQTVLFFISIFSVTLNAETPTWARLMAWAGIVLASIIWRVFL
SQAFSLPAVRRAYGRMQRVASRVIGAIIGVFALRLIYEGVTQR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagttagttcacttatttatggatgaaatcactatggatcctttgcatgccgtt
tacctgaccgtaggactgttcgtgattactttttttaatccgggagccaatctctttgtg
gtagtacaaaccagcctggcttccggtcgacgcgcaggggtgctgaccgggctgggcgtg
gcgctgggcgatgcattttattccgggttgggtttgtttggtcttgcaacgctaattacg
cagtgtgaggagattttttcgcttatcagaatcgtcggcggcgcttatctcttatggttt
gcgtggtgcagcatgcgccgccagtcaacaccgcaaatgagcacactacaacaaccgatt
agcgccccctggtatgtcttttttcgccgcggattaattaccgatctctctaacccgcaa
accgttttattttttatcagtattttctcagtaacattaaatgccgaaacaccaacatgg
gcacgtttaatggcctgggcggggattgtgctcgcatcaattatctggcgagtttttctt
agtcaggcgttttctttgcccgctgtgcgtcgtgcttatgggcgtatgcaacgcgttgcc
agtcgggttattggtgcaattattggtgtattcgcgctacgcctgatttacgaaggggtg
acgcagcggtga

DBGET integrated database retrieval system