KEGG   Escherichia coli K-12 MG1655: b0351Help
Entry
b0351             CDS       T00007                                 

Gene name
mhpF
Definition
acetaldehyde-CoA dehydrogenase II, NAD-binding (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:eco00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:eco00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:eco00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:eco00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:eco00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
372921..373871
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEAN
VDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcgtaaagtcgccattatcggttctggcaacattggtaccgatctgatgatt
aaaattttgcgtcacggtcagcatctggagatggcggtgatggttggcattgatcctcag
tccgacggtctggcgcgcgccagacgtatgggcgtcgccaccacccatgaaggggtgatc
ggactgatgaacatgcctgaatttgctgatatcgacattgtatttgatgcgaccagcgcc
ggtgctcatgtgaaaaacgatgccgctttacgcgaagcgaaaccggatattcgcttaatt
gacctgacgcctgctgccatcggcccttactgcgtgccggtggttaacctcgaggcgaac
gtcgatcaactgaacgtcaacatggtcacctgcggcggccaggccaccattccaatggtg
gcggcagtttcacgcgtggcgcgtgttcattacgccgaaattatcgcttctatcgccagt
aaatctgccggacctggcacgcgtgccaatatcgatgaatttacggaaaccacttcccga
gccattgaagtggtgggcggcgcggcaaaagggaaggcgattattgtgcttaacccagca
gagccaccgttgatgatgcgtgacacggtgtatgtattgagcgacgaagcttcacaagat
gatatcgaagcctcaatcaatgaaatggctgaggcggtgcaggcttacgtaccgggttat
cgcctgaaacagcgcgtgcagtttgaagttatcccgcaggataaaccggtcaatttaccg
ggcgtggggcaattctccggactgaaaacagcggtctggctggaagtcgaaggcgcagcg
cattatctgcctgcctatgcgggcaacctcgacattatgacttccagtgcgctggcgaca
gcggaaaaaatggcccagtcactggcgcgcaaggcaggagaagcggcatga

DBGET integrated database retrieval system