KEGG   Escherichia coli K-12 MG1655: b0351Help
Entry
b0351             CDS       T00007                                 

Gene name
mhpF
Definition
(RefSeq) acetaldehyde-CoA dehydrogenase II, NAD-binding
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00360  Phenylalanine metabolism
eco00362  Benzoate degradation
eco00620  Pyruvate metabolism
eco00621  Dioxin degradation
eco00622  Xylene degradation
eco00650  Butanoate metabolism
eco01100  Metabolic pathways
eco01120  Microbial metabolism in diverse environments
eco01220  Degradation of aromatic compounds
Module
eco_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    b0351 (mhpF)
   00650 Butanoate metabolism
    b0351 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    b0351 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    b0351 (mhpF)
   00622 Xylene degradation
    b0351 (mhpF)
   00621 Dioxin degradation
    b0351 (mhpF)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     b0351 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 945008
NCBI-ProteinID: NP_414885
Pasteur: mhpF
RegulonDB: ECK120004473
ECOCYC: M014
ASAP: ABE-0001207
UniProt: P77580
Position
372921..373871
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEAN
VDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcgtaaagtcgccattatcggttctggcaacattggtaccgatctgatgatt
aaaattttgcgtcacggtcagcatctggagatggcggtgatggttggcattgatcctcag
tccgacggtctggcgcgcgccagacgtatgggcgtcgccaccacccatgaaggggtgatc
ggactgatgaacatgcctgaatttgctgatatcgacattgtatttgatgcgaccagcgcc
ggtgctcatgtgaaaaacgatgccgctttacgcgaagcgaaaccggatattcgcttaatt
gacctgacgcctgctgccatcggcccttactgcgtgccggtggttaacctcgaggcgaac
gtcgatcaactgaacgtcaacatggtcacctgcggcggccaggccaccattccaatggtg
gcggcagtttcacgcgtggcgcgtgttcattacgccgaaattatcgcttctatcgccagt
aaatctgccggacctggcacgcgtgccaatatcgatgaatttacggaaaccacttcccga
gccattgaagtggtgggcggcgcggcaaaagggaaggcgattattgtgcttaacccagca
gagccaccgttgatgatgcgtgacacggtgtatgtattgagcgacgaagcttcacaagat
gatatcgaagcctcaatcaatgaaatggctgaggcggtgcaggcttacgtaccgggttat
cgcctgaaacagcgcgtgcagtttgaagttatcccgcaggataaaccggtcaatttaccg
ggcgtggggcaattctccggactgaaaacagcggtctggctggaagtcgaaggcgcagcg
cattatctgcctgcctatgcgggcaacctcgacattatgacttccagtgcgctggcgaca
gcggaaaaaatggcccagtcactggcgcgcaaggcaggagaagcggcatga

DBGET integrated database retrieval system