KEGG   Escherichia coli K-12 MG1655: b0377Help
Entry
b0377             CDS       T00007                                 

Gene name
sbmA
Definition
(RefSeq) microcin B17 transporter
  KO
K17938  
peptide/bleomycin uptake transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Others
   b0377 (sbmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
396639..397859
Genome map
AA seq 406 aa AA seqDB search
MFKSFFPKPGTFFLSAFVWALIAVIFWQAGGGDWVARITGASGQIPISAARFWSLDFLIF
YAYYIVCVGLFALFWFIYSPHRWQYWSILGTALIIFVTWFLVEVGVAVNAWYAPFYDLIQ
TALSSPHKVTIEQFYREVGVFLGIALIAVVISVLNNFFVSHYVFRWRTAMNEYYMANWQQ
LRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPVLVTLSAHVPELPIIGHIP
YGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRKELVYGEDDATRATPPTVRE
LFSAVRKNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFPSIVAGTITLGLMTQITNVFG
QVRGAFQYLINSWTTLVELMSIYKRLRSFEHELDGDKIQEVTHTLS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtcttttttcccaaagccgggaacgttttttctctcggccttcgtttgggca
ttgattgccgttatcttctggcaagccggtgggggtgactgggtggcgcgtatcaccggc
gcttccgggcagatcccgattagcgccgcgcgtttctggtcgttggatttcctgattttt
tacgcttactacattgtttgcgtaggactttttgcattgttctggtttatctacagcccg
catcgttggcaatactggtcaatactcggtactgcactgatcatcttcgtcacctggttt
ttggtggaagtcggggtcgccgtcaacgcctggtatgcgccgttctatgatctgattcaa
accgcgctaagttcgccgcataaagtcaccatcgaacaattttaccgcgaagtgggcgtc
tttctggggattgcgctgatcgctgtggtgatcagtgtgctgaacaacttctttgtcagt
cactacgtgttccgctggcgtacagcgatgaacgaatattacatggcgaactggcaacaa
ctgcgtcatatcgaaggggccgcacagcgtgtgcaggaagacaccatgcgttttgcttca
acgctggagaatatgggcgtcagttttatcaacgccatcatgacgttgatcgccttcctg
ccggtgctggtaacgctctccgcgcatgtgccggagctgccgattatcgggcacattccg
tatggtctggtgattgccgcaatcgtctggtcgctgatggggaccggattgctggcagtg
gtagggatcaaactgccggggctggagtttaaaaaccagcgtgtagaggctgcctaccgt
aaagagctggtttatggtgaagacgatgccacgcgcgcgacgccgcctacggtacgcgag
ctgtttagcgccgtacggaaaaactatttccgcctctattttcactatatgtatttcaac
atcgcccgcattctctatttgcaggtcgataacgttttcggtttgttcttgctgtttccg
tcaattgttgccggtacgattacgctcggcctgatgacgcagattaccaacgtttttggt
caggttcgcggtgctttccagtacctgattaactcatggaccacactggttgagttgatg
tctatctacaaacgtctgcgcagctttgaacatgagctggatggtgacaaaattcaggaa
gtaacccataccttgagctaa

DBGET integrated database retrieval system