KEGG   Escherichia coli K-12 MG1655: b0377Help
Entry
b0377             CDS       T00007                                 

Gene name
sbmA
Definition
(RefSeq) peptide antibiotic transporter
  KO
K17938  peptide/bleomycin uptake transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Others
   b0377 (sbmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SbmA_BacA ABC_membrane_2
Motif
Other DBs
NCBI-GeneID: 946884
NCBI-ProteinID: NP_414911
Pasteur: sbmA
RegulonDB: ECK120000917
ECOCYC: EG10928
ASAP: ABE-0001297
UniProt: P0AFY6
Position
396639..397859
Genome map
AA seq 406 aa AA seqDB search
MFKSFFPKPGTFFLSAFVWALIAVIFWQAGGGDWVARITGASGQIPISAARFWSLDFLIF
YAYYIVCVGLFALFWFIYSPHRWQYWSILGTALIIFVTWFLVEVGVAVNAWYAPFYDLIQ
TALSSPHKVTIEQFYREVGVFLGIALIAVVISVLNNFFVSHYVFRWRTAMNEYYMANWQQ
LRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPVLVTLSAHVPELPIIGHIP
YGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRKELVYGEDDATRATPPTVRE
LFSAVRKNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFPSIVAGTITLGLMTQITNVFG
QVRGAFQYLINSWTTLVELMSIYKRLRSFEHELDGDKIQEVTHTLS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtcttttttcccaaagccgggaacgttttttctctcggccttcgtttgggca
ttgattgccgttatcttctggcaagccggtgggggtgactgggtggcgcgtatcaccggc
gcttccgggcagatcccgattagcgccgcgcgtttctggtcgttggatttcctgattttt
tacgcttactacattgtttgcgtaggactttttgcattgttctggtttatctacagcccg
catcgttggcaatactggtcaatactcggtactgcactgatcatcttcgtcacctggttt
ttggtggaagtcggggtcgccgtcaacgcctggtatgcgccgttctatgatctgattcaa
accgcgctaagttcgccgcataaagtcaccatcgaacaattttaccgcgaagtgggcgtc
tttctggggattgcgctgatcgctgtggtgatcagtgtgctgaacaacttctttgtcagt
cactacgtgttccgctggcgtacagcgatgaacgaatattacatggcgaactggcaacaa
ctgcgtcatatcgaaggggccgcacagcgtgtgcaggaagacaccatgcgttttgcttca
acgctggagaatatgggcgtcagttttatcaacgccatcatgacgttgatcgccttcctg
ccggtgctggtaacgctctccgcgcatgtgccggagctgccgattatcgggcacattccg
tatggtctggtgattgccgcaatcgtctggtcgctgatggggaccggattgctggcagtg
gtagggatcaaactgccggggctggagtttaaaaaccagcgtgtagaggctgcctaccgt
aaagagctggtttatggtgaagacgatgccacgcgcgcgacgccgcctacggtacgcgag
ctgtttagcgccgtacggaaaaactatttccgcctctattttcactatatgtatttcaac
atcgcccgcattctctatttgcaggtcgataacgttttcggtttgttcttgctgtttccg
tcaattgttgccggtacgattacgctcggcctgatgacgcagattaccaacgtttttggt
caggttcgcggtgctttccagtacctgattaactcatggaccacactggttgagttgatg
tctatctacaaacgtctgcgcagctttgaacatgagctggatggtgacaaaattcaggaa
gtaacccataccttgagctaa

DBGET integrated database retrieval system