KEGG   Escherichia coli K-12 MG1655: b0383Help
Entry
b0383             CDS       T00007                                 

Gene name
phoA
Definition
bacterial alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eco00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:eco00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:eco02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
401747..403162
Genome map
AA seq 471 aa AA seqDB search
MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLS
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGN
IDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggcactcttaccgttactgtttacccctgtgacaaaa
gcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgca
cccggcggtgctcgccgtttaacgggtgatcagactgccgctctgcgtgattctcttagc
gataaacctgcaaaaaatattattttgctgattggcgatgggatgggggactcggaaatt
actgccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatagatgcctta
ccgcttaccgggcaatacactcactatgcgctgaataaaaaaaccggcaaaccggactac
gtcaccgactcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagcc
gcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcg
ctggtggcacatgtgacctcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgt
ccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctgcttaacgct
cgtgccgacgttacgcttggcggcggcgcaaaaacctttgctgaaacggcaaccgctggt
gaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtgagc
gatgctgcctcactgaattcggtgacggaagcgaatcagcaaaaacccctgcttggcctg
tttgctgacggcaatatgccagtgcgctggctaggaccgaaagcaacgtaccatggcaat
atcgataagcccgcagtcacctgtacgccaaatccgcaacgtaatgacagtgtaccaacc
ctggcgcagatgaccgacaaagccattgaattgttgagtaaaaatgagaaaggctttttc
ctgcaagttgaaggtgcgtcaatcgataaacaggatcatgctgcgaatccttgtgggcaa
attggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattcgctaaaaag
gagggtaacacgctggtcatagtcaccgctgatcacgcccacgccagccagattgttgcg
ccggataccaaagctccgggcctcacccaggcgctaaataccaaagatggcgcagtgatg
gtgatgagttacgggaactccgaagaggattcacaagaacataccggcagtcagttgcgt
attgcggcgtatggcccgcatgccgccaatgttgttggactgaccgaccagaccgatctc
ttctacaccatgaaagccgctctggggctgaaataa

DBGET integrated database retrieval system