KEGG   Escherichia coli K-12 MG1655: b0413Help
Entry
b0413             CDS       T00007                                 

Gene name
nrdR
Definition
(RefSeq) Nrd regulon repressor
  KO
K07738  
transcriptional repressor NrdR
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Other transcription factors
   Others
    b0413 (nrdR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
433002..433451
Genome map
AA seq 149 aa AA seqDB search
MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREP
FNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVPSKMIGNLVMEQLKKLD
KVAYIRFASVYRSFEDIKEFGEEIARLED
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgcattgcccattctgtttcgccgtggacactaaggtaattgactctcgtctcgtgggc
gagggttcatccgtacgccgccgtcggcagtgtctggtgtgtaatgaacgtttcaccacc
tttgaagtggcggagctggttatgccgcgtgttgtaaaaagcaacgacgtgcgtgaaccg
tttaatgaagagaaattgcgtagcggaatgctgcgggcgctggaaaaacgtccggtgagt
tccgatgacgtcgaaatggcaatcaatcatattaaatcgcagctgcgcgccaccggtgag
cgcgaagtgccgagcaagatgattggcaatctggtgatggagcaattgaaaaagctcgat
aaagtcgcctatatccgttttgcctctgtctaccgcagtttcgaagatatcaaagaattt
ggcgaagagatcgcgcgcctggaggactaa

DBGET integrated database retrieval system