KEGG   Escherichia coli K-12 MG1655: b0415Help
Entry
b0415             CDS       T00007                                 

Gene name
ribE
Definition
(RefSeq) riboflavin synthase beta chain (EC:2.5.1.9)
  KO
K00794  
6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    b0415 (ribE)
Enzymes [BR:eco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.78  6,7-dimethyl-8-ribityllumazine synthase
     b0415 (ribE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
434647..435117
Genome map
AA seq 156 aa AA seqDB search
MNIIEANVATPDARVAITIARFNNFINDSLLEGAIDALKRIGQVKDENITVVWVPGAYEL
PLAAGALAKTGKYDAVIALGTVIRGGTAHFEYVAGGASNGLAHVAQDSEIPVAFGVLTTE
SIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaacattattgaagctaacgttgctaccccggacgctcgcgtcgccatcaccatcgcg
cgtttcaacaactttatcaatgacagcctgctggaaggtgcaattgacgcactgaaacgt
atcggtcaggtaaaagatgaaaacattaccgttgtttgggtgcctggtgcctatgagctg
ccgctggcggcgggtgcactggctaaaaccggtaaatacgacgcggtgattgcgctgggt
acggttattcgtggtggcactgcccactttgaatatgtcgctggtggtgcaagcaacggc
ctggcgcatgttgcccaggacagcgaaattccggttgcttttggggttctgaccactgaa
agcattgaacaagcgatcgaacgtgctggcaccaaagctggcaacaaaggtgcagaagct
gcactgaccgcgcttgaaatgattaatgtattgaaagccatcaaggcctga

DBGET integrated database retrieval system