KEGG   Escherichia coli K-12 MG1655: b0429Help
Entry
b0429             CDS       T00007                                 

Gene name
cyoD
Definition
(RefSeq) cytochrome o ubiquinol oxidase subunit IV (EC:1.10.3.-)
  KO
K02300  
cytochrome o ubiquinol oxidase subunit IV
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome o ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    b0429 (cyoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(447717..448046)
Genome map
AA seq 109 aa AA seqDB search
MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAVILGTILAMAVVQVLV
HLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMMMH
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgagtcattctaccgatcacagcggcgcgtcccatggcagcgtaaaaacctacatgaca
ggctttatcctgtcgatcattctgacggtgattccgttctggatggtgatgacaggagct
gcctctccggccgtaattctgggaacaatcctggcaatggcagtggtacaggttctggtg
catctggtgtgcttcctgcacatgaataccaaatcagatgaaggctggaacatgacggcg
tttgtcttcaccgtgctaatcatcgctatcctggttgtaggctccatctggattatgtgg
aacctcaactacaacatgatgatgcactaa

DBGET integrated database retrieval system