KEGG   Escherichia coli K-12 MG1655: b0430Help
Entry
b0430             CDS       T00007                                 

Gene name
cyoC
Definition
(RefSeq) cytochrome o ubiquinol oxidase subunit III
  KO
K02299  
cytochrome o ubiquinol oxidase subunit III
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome o ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    b0430 (cyoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(448046..448660)
Genome map
AA seq 204 aa AA seqDB search
MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTG
KDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLALTWLFGAGFIGMEIYEF
HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL
SLFWHFLDVVWICVFTVVYLMGAM
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgatactttgacgcacgcgactgcccacgcgcacgaacacgggcaccacgat
gcaggcggaaccaaaatcttcggattttggatctacctgatgagcgactgcattctgttc
tctatcttgtttgctacctatgccgttctggtgaacggcaccgcaggcggcccgacaggt
aaggacattttcgaactgccgttcgttctggttgaaactttcttgctgttgttcagctcc
atcacctacggcatggcggctatcgccatgtacaaaaacaacaaaagccaggttatctcc
tggctggcgttgacctggttgtttggtgccggatttatcgggatggaaatctatgaattc
catcacctgattgttaacggcatgggtccggatcgcagcggcttcctgtcagcgttcttt
gcgctggtcggcacgcacggtctgcacgtcacttctggtcttatctggatggcggtgctg
atggtgcaaatcgcccgtcgcggcctgaccagcactaaccgtacccgcatcatgtgcctg
agcctgttctggcacttcctggatgtggtttggatctgtgtgttcactgttgtttatctg
atgggggcgatgtaa

DBGET integrated database retrieval system