KEGG   Escherichia coli K-12 MG1655: b0430Help
Entry
b0430             CDS       T00007                                 

Gene name
cyoC
Definition
(RefSeq) cytochrome o ubiquinol oxidase subunit III
  KO
K02299  cytochrome o ubiquinol oxidase subunit III
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00190  Oxidative phosphorylation
eco01100  Metabolic pathways
Module
eco_M00417  Cytochrome o ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    b0430 (cyoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX3 ACT_6
Motif
Other DBs
NCBI-GeneID: 946897
NCBI-ProteinID: NP_414964
Pasteur: cyoC
RegulonDB: ECK120000175
ECOCYC: EG10180
ASAP: ABE-0001491
UniProt: P0ABJ3
Structure
PDB: 

Jmol
Position
complement(448046..448660)
Genome map
AA seq 204 aa AA seqDB search
MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTG
KDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLALTWLFGAGFIGMEIYEF
HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL
SLFWHFLDVVWICVFTVVYLMGAM
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgatactttgacgcacgcgactgcccacgcgcacgaacacgggcaccacgat
gcaggcggaaccaaaatcttcggattttggatctacctgatgagcgactgcattctgttc
tctatcttgtttgctacctatgccgttctggtgaacggcaccgcaggcggcccgacaggt
aaggacattttcgaactgccgttcgttctggttgaaactttcttgctgttgttcagctcc
atcacctacggcatggcggctatcgccatgtacaaaaacaacaaaagccaggttatctcc
tggctggcgttgacctggttgtttggtgccggatttatcgggatggaaatctatgaattc
catcacctgattgttaacggcatgggtccggatcgcagcggcttcctgtcagcgttcttt
gcgctggtcggcacgcacggtctgcacgtcacttctggtcttatctggatggcggtgctg
atggtgcaaatcgcccgtcgcggcctgaccagcactaaccgtacccgcatcatgtgcctg
agcctgttctggcacttcctggatgtggtttggatctgtgtgttcactgttgtttatctg
atgggggcgatgtaa

DBGET integrated database retrieval system