KEGG   Escherichia coli K-12 MG1655: b0431Help
Entry
b0431             CDS       T00007                                 

Gene name
cyoB
Definition
(RefSeq) cytochrome o ubiquinol oxidase subunit I (EC:1.10.3.-)
  KO
K02298  
cytochrome o ubiquinol oxidase subunit I [EC:1.10.3.10]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome o ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    b0431 (cyoB)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.10  ubiquinol oxidase (H+-transporting)
     b0431 (cyoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(448650..450641)
Genome map
AA seq 663 aa AA seqDB search
MFGKLSLDAVPFHEPIVMVTIAGIILGGLALVGLITYFGKWTYLWKEWLTSVDHKRLGIM
YIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFTAHGVIMIFFVAMPFVI
GLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNVSLGVGEFAQTGWLAYPPLSGIE
YSPGVGVDYWIWSLQLSGIGTTLTGINFFVTILKMRAPGMTMFKMPVFTWASLCANVLII
ASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWAWGHPEVYILILPVFGVFSE
IAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGAGANVNAFFGITTMIIAIPTG
VKIFNWLFTMYQGRIVFHSAMLWTIGFIVTFSVGGMTGVLLAVPGADFVLHNSLFLIAHF
HNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFWFWIIGFFVAFMPLYALGFMGMT
RRLSQQIDPQFHTMLMIAASGAVLIALGILCLVIQMYVSIRDRDQNRDLTGDPWGGRTLE
WATSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYKKPDHYEEIHMPKNSGAGIVIAAFST
IFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVDYYVPVAEIEKLENQHFDEITKAGLK
NGN
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgttcggaaaattatcacttgatgcagtcccgttccatgaacctatcgtcatggttacg
atcgctggcattattttgggaggtctggcgctcgttggcctgatcacttacttcggtaag
tggacctacctgtggaaagagtggctgacctccgtcgaccataaacgcctcggtatcatg
tatatcatcgtggcgattgtgatgttgctgcgtggttttgctgacgccattatgatgcgt
agccagcaggctcttgcctcggcgggcgaagcgggcttcctgccacctcaccactacgat
cagatctttaccgcgcacggcgtgattatgatcttcttcgtggcgatgcctttcgttatc
ggtctgatgaacctggtggttccgctgcagatcggcgcgcgtgacgttgcgttcccgttc
ctcaacaacttaagcttctggtttaccgttgttggtgtgattctggttaacgtttctctc
ggcgtgggcgaatttgcgcagaccggctggctggcctatccaccgctatcgggaatagag
tacagtccgggagtcggtgtcgattactggatatggagtctccagctatccggtataggt
acgacgcttaccggtatcaacttcttcgttaccattctgaagatgcgcgcaccgggcatg
accatgttcaagatgccagtatttacctgggcatcactgtgcgcgaacgtactgattatt
gcttccttcccaattctgacggttaccgtcgcgttgttgaccctggatcgctatctgggc
acccatttctttaccaacgatatgggtggcaacatgatgatgtacatcaacctgatttgg
gcctggggccacccggaagtttacatcctgatcctgcctgttttcggtgtgttctccgaa
attgcggcaaccttctcgcgtaaacgtctgtttggttatacctcgctggtatgggcaacc
gtctgtatcaccgtgctgtcgttcatcgtttggctgcaccacttctttacgatgggtgcg
ggcgcgaacgtaaacgccttctttggtatcaccacaatgattatcgccatcccgaccggg
gtgaagatcttcaactggctgttcaccatgtatcagggccgcatcgtgttccattctgcg
atgctgtggaccatcggttttatcgtcaccttctcggtgggcgggatgactggcgtgctg
ctggccgtaccgggcgcggacttcgttctgcataacagcctgttcctgattgcgcacttc
cataacgtgatcatcggcggcgtggtcttcggctgcttcgcagggatgacctactggtgg
cctaaagcgttcggtttcaaactgaacgaaacctggggtaaacgcgcgttctggttctgg
atcatcggcttcttcgttgcctttatgccactgtatgcgctgggcttcatgggcatgacc
cgtcgtttgagccagcagattgacccgcagttccacaccatgctgatgattgcagccagc
ggtgcagtactgattgcgctgggtattctctgcctcgttattcagatgtacgtttctatt
cgcgaccgcgaccagaaccgtgacctgactggcgacccgtggggtggccgtacgctggag
tgggcaacctcttccccgcctccgttctataactttgccgtagtgccgcacgttcacgaa
cgtgatgcattctgggaaatgaaagagaaaggcgaagcgtataaaaagcctgaccactat
gaagaaattcatatgccgaaaaacagcggtgcaggtatcgtcattgcagctttctccacc
atcttcggtttcgccatgatctggcatatctggtggctggcgattgttggcttcgcaggc
atgatcatcacctggatcgtgaaaagcttcgacgaggacgtggattactacgtgccggtg
gcagaaatcgaaaaactggaaaaccagcatttcgatgagattactaaggcagggctgaaa
aatggcaactga

DBGET integrated database retrieval system