KEGG   Escherichia coli K-12 MG1655: b0432Help
Entry
b0432             CDS       T00007                                 

Gene name
cyoA
Definition
(RefSeq) cytochrome o ubiquinol oxidase subunit II (EC:1.10.3.-)
  KO
K02297  
cytochrome o ubiquinol oxidase subunit II [EC:1.10.3.10]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome o ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    b0432 (cyoA)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.10  ubiquinol oxidase (H+-transporting)
     b0432 (cyoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(450663..451610)
Genome map
AA seq 315 aa AA seqDB search
MRLRKYNKSLGWLSLFAGTVLLSGCNSALLDPKGQIGLEQRSLILTAFGLMLIVVIPAIL
MAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLAVLTWKTTHALEPSKPL
AHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYFKVTSNSVMNSFFIPRLG
SQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKAIATPDRAAFDQWVAKAKQ
SPNTMSDMAAFEKLAAPSEYNQVEYFSNVKPDLFADVINKFMAHGKSMDMTQPEGEHSAH
EGMEGMDMSHAESAH
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagactcaggaaatacaataaaagtttgggatggttgtcattatttgcaggcactgta
ttgctcagtggctgtaattctgcgctgttagatcccaaaggacagattggtctggagcaa
cgttcactgatactgacggcatttggcctgatgttgattgtcgttattcccgcaatcttg
atggctgttggtttcgcctggaagtaccgtgcgagcaataaagatgctaagtacagcccg
aactggtcacactccaataaagtggaagctgtggtctggacggtacctatcttaatcatc
atcttccttgcagtactgacctggaaaaccactcacgctcttgagcctagcaagccgctg
gcacacgacgagaagcccattaccatcgaagtggtttccatggactggaaatggttcttc
atctacccggaacagggcattgctaccgtgaatgaaatcgctttcccggcgaacactccg
gtgtacttcaaagtgacctccaactccgtgatgaactccttcttcattccgcgtctgggt
agccagatttatgccatggccggtatgcagactcgcctgcatctgatcgccaacgaaccc
ggcacttatgacggtatctccgccagctacagcggcccgggcttctcaggcatgaagttc
aaagctattgcaacaccggatcgcgccgcattcgaccagtgggtcgcaaaagcgaagcag
tcgccgaacaccatgtctgacatggctgcgttcgaaaaactggccgcgcctagcgaatac
aaccaggtggaatatttctccaacgtgaaaccagacttgtttgccgatgtaattaacaag
tttatggctcacggtaagagcatggacatgacccagccagaaggtgagcacagcgcacac
gaaggtatggaaggcatggacatgagccacgcggaatccgcccattaa

DBGET integrated database retrieval system