KEGG   Escherichia coli K-12 MG1655: b0433Help
Entry
b0433             CDS       T00007                                 

Gene name
ampG
Definition
(RefSeq) muropeptide transporter
  KO
K08218  
MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG
Organism
eco  Escherichia coli K-12 MG1655
Pathway
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:eco00001]
 Human Diseases
  Antimicrobial resistance
   01501 beta-Lactam resistance
    b0433 (ampG)
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Protein transporters
   Peptide-acetyl-CoA transporter (PAT) [TC:2.A.1.25]
    b0433 (ampG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(452070..453545)
Genome map
AA seq 491 aa AA seqDB search
MSSQYLRIFQQPRSAILLILGFASGLPLALTSGTLQAWMTVENIDLKTIGFFSLVGQAYV
FKFLWSPLMDRYTPPFFGRRRGWLLATQILLLVAIAAMGFLEPGTQLRWMAALAVVIAFC
SASQDIVFDAWKTDVLPAEERGAGAAISVLGYRLGMLVSGGLALWLADKWLGWQGMYWLM
AALLIPCIIATLLAPEPTDTIPVPKTLEQAVVAPLRDFFGRNNAWLILLLIVLYKLGDAF
AMSLTTTFLIRGVGFDAGEVGVVNKTLGLLATIVGALYGGILMQRLSLFRALLIFGILQG
ASNAGYWLLSITDKHLYSMGAAVFFENLCGGMGTSAFVALLMTLCNKSFSATQFALLSAL
SAVGRVYVGPVAGWFVEAHGWSTFYLFSVAAAVPGLILLLVCRQTLEYTRVNDNFISRTA
YPAGYAFAMWTLAAGVSLLAVWLLLLTMDALDLTHFSFLPALLEVGVLVALSGVVLGGLL
DYLALRKTHLT
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtcaatatttacgtatttttcaacagccgcgttcagccatattgctgatcctg
ggttttgcttccgggctaccgctcgccctgacatccggtaccttacaggcctggatgacg
gtcgagaatatcgatctcaaaaccattggtttcttctctctggtaggccaggcttacgtt
tttaaattcctctggtcaccgctgatggaccgctacacgcctccattttttgggcggcgg
cgcggttggctgctcgccacgcaaatcctgttattagtcgccattgcggcgatgggtttt
ctcgaaccaggcacccaactccgctggatggcggcgctggcagtggtgatcgctttttgc
tctgcttcccaggatatagtcttcgatgcgtggaaaaccgatgtgcttccggcagaagaa
cgtggtgcgggcgcggcaatcagcgtgctgggttaccgtttagggatgctggtttccggc
ggcctagccctgtggctggcagataaatggctgggctggcagggcatgtactggttaatg
gcggcactgttgatcccctgtattatcgcgacgttgcttgcaccagaaccaaccgacacc
attcctgtgcccaaaacgctggaacaagcggttgttgcacctctgcgagatttctttggt
cgcaataatgcctggcttattttgcttcttatcgtgctgtataagctgggcgacgcattc
gccatgagcctgacaaccacgtttttgattcgcggcgtcgggtttgatgcgggtgaagta
ggcgtggttaacaaaacgcttggcttactagcgaccattgttggcgcattgtacggtggg
attttgatgcagcgcctgtcactgttccgggcactgctgattttcggcattttacaaggt
gcgtctaacgccggttactggctgctgtcgattactgataagcatctctacagcatgggc
gcagccgtctttttcgaaaacctctgtggcgggatgggcacatcagcctttgtcgcgctg
ttaatgacgctatgtaataagtcattttccgctactcaatttgccctgctctcagcgctt
tctgctgtagggcgagtttatgtcggccccgtggcgggttggtttgttgaagcacacggc
tggtcgacattctatctattctccgtcgccgctgccgtaccagggcttattttgctgctg
gtttgccgccagacgcttgaatatacacgagtaaatgacaactttatctcccgtaccgca
tatccggcaggttatgcctttgccatgtggacactggcggcgggcgtcagcctgttggcc
gtgtggttactgctattgacgatggacgcgctggatttgacgcacttctctttcctgcct
gctctgctggaagtcggggttttagtcgccctttctggcgtcgtgcttggtggtttgctg
gattatctggcgctacgaaaaacgcatctgacgtaa

DBGET integrated database retrieval system