KEGG   Escherichia coli K-12 MG1655: b0442Help
Entry
b0442             CDS       T00007                                 

Gene name
ybaV
Definition
(RefSeq) putative competence-suppressing periplasmic helix-hairpin-helix DNA-binding protein
  KO
K02237  
competence protein ComEA
Organism
eco  Escherichia coli K-12 MG1655
Brite
Secretion system [BR:eco02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   b0442 (ybaV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
463937..464308
Genome map
AA seq 123 aa AA seqDB search
MKHGIKALLITLSLACAGMSHSALAAASVAKPTAVETKAEAPAAQSKAAVPAKASDEEGT
RVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLKQVPGMGNSLVERNLAV
LTL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacggaattaaagcactgctcattaccctgtccctggcctgtgccggaatgtct
catagcgcgctggcggcagcttctgtggcgaaaccgacggcggtagaaaccaaagcggaa
gctcctgcagcacaaagtaaagcagcagtaccggcgaaagccagtgacgaagaaggcacc
cgggtcagcattaataatgccagcgcggaagagctagcccgcgcgatgaatggcgttggc
ctgaagaaagcgcaggcgattgtcagttatcgcgaagagtacggtccgtttaaaactgtg
gaggatctaaagcaggtgccggggatgggcaattcgctggtggaacgtaatctggcggta
ttaaccctgtaa

DBGET integrated database retrieval system