KEGG   Escherichia coli K-12 MG1655: b0444Help
Entry
b0444             CDS       T00007                                 

Gene name
queC
Definition
(RefSeq) 7-cyano-7-deazaguanine (preQ0) synthase; queuosine biosynthesis
  KO
K06920  
7-cyano-7-deazaguanine synthase [EC:6.3.4.20]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    b0444 (queC)
Enzymes [BR:eco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.20  7-cyano-7-deazaguanine synthase
     b0444 (queC)
Transfer RNA biogenesis [BR:eco03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    b0444 (queC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(464852..465547)
Genome map
AA seq 231 aa AA seqDB search
MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDVARELALKLGARAHKV
LDVTLLNELAVSSLTRDSIPVPDYEPEADGIPNTFVPGRNILFLTLAAIYAYQVKAEAVI
TGVCETDFSGYPDCRDEFVKALNHAVSLGMAKDIRFETPLMWIDKAETWALADYYGKLDL
VRNETLTCYNGFKGDGCGHCAACNLRANGLNHYLADKPTVMAAMKQKTGLR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgctgtcgttgtgttcagtggaggtcaggattccaccacctgtctggtgcag
gcattacaacaatatgatgaagtccattgcgtgacgttcgattacggtcagcggcatcgc
gcagaaatcgacgtggcacgcgaactggcgctgaaactgggggcacgcgcgcataaggtg
ctggatgtcaccctgctcaacgagctggcggtcagtagcctgacgcgtgacagcattccg
gtgcctgattatgaacctgaagccgatggtatcccgaatacgtttgtcccagggcgtaat
attttgttcctgacgctggcggcaatatatgcgtatcaggtaaaagcagaagccgtaatt
actggcgtctgcgaaacggatttctccggctacccggattgccgcgatgagtttgtgaaa
gcactaaaccatgccgtcagtttgggcatggcgaaagatattcgttttgaaacgccgctg
atgtggattgataaagcggaaacctgggcgctggcagattattacggcaaactggattta
gtccgtaacgaaacgttgacctgctataacggctttaaaggcgacggttgcggtcattgt
gcggcatgtaatttacgcgccaacggtttgaatcattatctggccgataaaccgacggtg
atggcagcgatgaagcagaaaaccgggttgaggtaa

DBGET integrated database retrieval system