KEGG   Escherichia coli K-12 MG1655: b0451Help
Entry
b0451             CDS       T00007                                 

Gene name
amtB
Definition
(RefSeq) ammonium transporter
  KO
K03320  
ammonium transporter, Amt family
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b0451 (amtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
472966..474252
Genome map
AA seq 428 aa AA seqDB search
MKIATIKTGLASLAMLPGLVMAAPAVADKADNAFMMICTALVLFMTIPGIALFYGGLIRG
KNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNNFFGNINWLMLKNIELTAVMGSIYQY
IHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWLTLSYIPIAHMVWGGGLLASHGA
LDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFKPHNLPMVFTGTAILYIGWFGFNAG
SAGTANEIAALAFVNTVVATAAAILGWIFGEWALRGKPSLLGACSGAIAGLVGVTPACGY
IGVGGALIIGVVAGLAGLWGVTMLKRLLRVDDPCDVFGVHGVCGIVGCIMTGIFAASSLG
GVGFAEGVTMGHQLLVQLESIAITIVWSGVVAFIGYKLADLTVGLRVPEEQEREGLDVNS
HGENAYNA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagcgacgataaaaactgggcttgcttcactggcgatgcttccgggactggta
atggctgcacctgcggtggccgataaagccgacaatgcgtttatgatgatttgtactgcg
ctggtgctgtttatgactattccggggattgccctgttttacggtgggttgattcgcggc
aaaaacgtgctgtcgatgctgacgcaggtgacggtgacatttgcactggtctgtattctc
tgggtggtttacggttactcgctggcgtttggtgagggcaacaacttcttcggcaacatt
aactggttgatgctgaaaaacatcgaactgacggcggtgatgggcagcatttatcagtat
atccacgtggcgtttcagggatcgtttgcctgcattaccgtcggcttgatagttggggcg
ctggcggaacgaatccgcttctcagctgtgttgattttcgtggtggtatggctgacgctc
tcttacattccgattgcgcatatggtgtggggcggtggtttgctggcttctcacggtgcg
ctggatttcgcgggtggcaccgtggtgcacattaacgccgcaatcgccggtctggtgggc
gcgtatctgataggaaaacgcgtgggcttcggtaaagaggcgtttaaaccgcacaacctg
ccgatggtcttcaccgggactgccattctctatatcggttggtttggctttaacgccggg
tcagcgggcacggcgaatgaaatcgcggcactggcatttgtgaatactgtggtcgcaacg
gcggcggcaattcttggctggatcttcggtgaatgggcgctgcgtggtaagccttcactg
ctgggggcgtgttctggcgcgattgccggtctggtcggcgtgacgccagcctgcggctac
attggggttggcggcgcgttgattatcggcgtggtagctggtctggcgggcttgtggggc
gttaccatgctcaaacgcttgctgcgggtggatgatccctgcgatgtcttcggtgtgcac
ggcgtttgtggcattgtcggctgtatcatgaccgggatttttgccgccagctcgctgggc
ggcgtgggcttcgctgaaggtgtgacgatgggccatcagttgctggtacagctggaaagc
atcgccattacgatcgtctggtccggtgttgtggcatttatcggctacaaattggcggat
ctgacggttggtctgcgtgtaccggaagagcaggagcgagaagggctggatgtcaacagc
cacggcgagaatgcctataacgcgtaa

DBGET integrated database retrieval system