KEGG   Escherichia coli K-12 MG1655: b0459Help
Entry
b0459             CDS       T00007                                 

Gene name
maa
Definition
(RefSeq) maltose O-acetyltransferase (EC:2.3.1.79)
  KO
K00661  
maltose O-acetyltransferase [EC:2.3.1.79]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.79  maltose O-acetyltransferase
     b0459 (maa)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(479367..479918)
Genome map
AA seq 183 aa AA seqDB search
MSTEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQVTEA
YIEPTFRCDYGYNIFLGNNFFANFDCVMLDVCPIRIGDNCMLAPGVHIYTATHPIDPVAR
NSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPDNVVVGGNPARII
KKL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagaaaaagaaaagatgattgctggtgagttgtatcgctcggcagatgagacg
ttatctcgcgatcgcctgcgcgctcgtcagcttattcaccgatacaatcattccctggcg
gaagagcacacattacgccagcaaattctcgctgatctattcggtcaggtgacagaggct
tatattgagccaacgtttcgctgtgactatggctataacatttttctcggtaataatttt
ttcgccaacttcgattgcgtgatgcttgatgtctgccctattcgcatcggtgataactgt
atgttggcaccaggcgttcatatctacacggcaacacatcccatcgaccctgtagcacgt
aatagcggtgctgaactggggaaacccgtcaccatcggtaataacgtctggattggcgga
cgcgcggtcattaaccctggtgtgaccattggtgataacgtcgtggtagcctcaggtgca
gttgtcacaaaagatgtcccggacaacgttgtcgtgggcggtaatccagccagaataatt
aaaaaattgtaa

DBGET integrated database retrieval system