KEGG   Escherichia coli K-12 MG1655: b0463Help
Entry
b0463             CDS       T00007                                 

Gene name
acrA
Definition
(RefSeq) multidrug efflux system
  KO
K03585  
membrane fusion protein, multidrug efflux system
Organism
eco  Escherichia coli K-12 MG1655
Pathway
beta-Lactam resistance
Cationic antimicrobial peptide (CAMP) resistance
Module
Multidrug resistance, efflux pump AcrAD-TolC
Multidrug resistance, efflux pump AcrAB-TolC/SmeDEF
Brite
KEGG Orthology (KO) [BR:eco00001]
 Human Diseases
  Antimicrobial resistance
   01501 beta-Lactam resistance
    b0463 (acrA)
   01503 Cationic antimicrobial peptide (CAMP) resistance
    b0463 (acrA)
Chromosome [BR:eco03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    b0463 (acrA)
Transporters [BR:eco02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   b0463 (acrA)
Antimicrobial resistance genes [BR:eco01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    b0463 (acrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(484426..485619)
Genome map
AA seq 397 aa AA seqDB search
MNKNRGFTPLAVVLMLSGSLALTGCDDKQAQQGGQQMPAVGVVTVKTEPLQITTELPGRT
SAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQATYDSAKGDLAKAQAAAN
IAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPI
SGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDFLRLKQELANGTLKQENG
KAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFPNPDHTLLPGMFVRARLEEG
LNPNAILVPQQGVTRTPRGDATVLVVGADDKVETRPIVASQAIGDKWLVTEGLKAGDRVV
ISGLQKVRPGVQVKAQEVTADNNQQAASGAQPEQSKS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaacagagggtttacgcctctggcggtcgttctgatgctctcaggcagctta
gccctaacaggatgtgacgacaaacaggcccaacaaggtggccagcagatgcccgccgtt
ggcgtagtaacagtcaaaactgaacctctgcagatcacaaccgagcttccgggtcgcacc
agtgcctaccggatcgcagaagttcgtcctcaagttagcgggattatcctgaagcgtaat
ttcaaagaaggtagcgacatcgaagcaggtgtctctctctatcagattgatcctgcgacc
tatcaggcgacatacgacagtgcgaaaggtgatctggcgaaagcccaggctgcagccaat
atcgcgcaattgacggtgaatcgttatcagaaactgctcggtactcagtacatcagtaag
caagagtacgatcaggctctggctgatgcgcaacaggcgaatgctgcggtaactgcggcg
aaagctgccgttgaaactgcgcggatcaatctggcttacaccaaagtcacctctccgatt
agcggtcgcattggtaagtcgaacgtgacggaaggcgcattggtacagaacggtcaggcg
actgcgctggcaaccgtgcagcaacttgatccgatctacgttgatgtgacccagtccagc
aacgacttcctgcgcctgaaacaggaactggcgaatggcacgctgaaacaagagaacggc
aaagccaaagtgtcactgatcaccagtgacggcattaagttcccgcaggacggtacgctg
gaattctctgacgttaccgttgatcagaccactgggtctatcaccctacgcgctatcttc
ccgaacccggatcacactctgctgccgggtatgttcgtgcgcgcacgtctggaagaaggg
cttaatccaaacgctattttagtcccgcaacagggcgtaacccgtacgccgcgtggcgat
gccaccgtactggtagttggcgcggatgacaaagtggaaacccgtccgatcgttgcaagc
caggctattggcgataagtggctggtgacagaaggtctgaaagcaggcgatcgcgtagta
ataagtgggctgcagaaagtgcgtcctggtgtccaggtaaaagcacaagaagttaccgct
gataataaccagcaagccgcaagcggtgctcagcctgaacagtccaagtcttaa

DBGET integrated database retrieval system