KEGG   Escherichia coli K-12 MG1655: b0463Help
Entry
b0463             CDS       T00007                                 

Gene name
acrA
Definition
(RefSeq) multidrug efflux system
  KO
K03585  membrane fusion protein, multidrug efflux system
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco01501  beta-Lactam resistance
eco01503  Cationic antimicrobial peptide (CAMP) resistance
Module
eco_M00646  Multidrug resistance, efflux pump AcrAD-TolC
eco_M00647  Multidrug resistance, efflux pump AcrAB-TolC/SmeDEF
Brite
KEGG Orthology (KO) [BR:eco00001]
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    b0463 (acrA)
   01503 Cationic antimicrobial peptide (CAMP) resistance
    b0463 (acrA)
Chromosome and associated proteins [BR:eco03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    b0463 (acrA)
Transporters [BR:eco02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   b0463 (acrA)
Antimicrobial resistance genes [BR:eco01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    b0463 (acrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD HlyD_D23 Biotin_lipoyl_2 HlyD_3 OEP
Motif
Other DBs
NCBI-GeneID: 945112
NCBI-ProteinID: NP_414996
Pasteur: acrA
RegulonDB: ECK120001646
ECOCYC: EG11703
ASAP: ABE-0001603
UniProt: P0AE06
Structure
PDB: 

Jmol
Position
complement(484426..485619)
Genome map
AA seq 397 aa AA seqDB search
MNKNRGFTPLAVVLMLSGSLALTGCDDKQAQQGGQQMPAVGVVTVKTEPLQITTELPGRT
SAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQATYDSAKGDLAKAQAAAN
IAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPI
SGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDFLRLKQELANGTLKQENG
KAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFPNPDHTLLPGMFVRARLEEG
LNPNAILVPQQGVTRTPRGDATVLVVGADDKVETRPIVASQAIGDKWLVTEGLKAGDRVV
ISGLQKVRPGVQVKAQEVTADNNQQAASGAQPEQSKS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaacagagggtttacgcctctggcggtcgttctgatgctctcaggcagctta
gccctaacaggatgtgacgacaaacaggcccaacaaggtggccagcagatgcccgccgtt
ggcgtagtaacagtcaaaactgaacctctgcagatcacaaccgagcttccgggtcgcacc
agtgcctaccggatcgcagaagttcgtcctcaagttagcgggattatcctgaagcgtaat
ttcaaagaaggtagcgacatcgaagcaggtgtctctctctatcagattgatcctgcgacc
tatcaggcgacatacgacagtgcgaaaggtgatctggcgaaagcccaggctgcagccaat
atcgcgcaattgacggtgaatcgttatcagaaactgctcggtactcagtacatcagtaag
caagagtacgatcaggctctggctgatgcgcaacaggcgaatgctgcggtaactgcggcg
aaagctgccgttgaaactgcgcggatcaatctggcttacaccaaagtcacctctccgatt
agcggtcgcattggtaagtcgaacgtgacggaaggcgcattggtacagaacggtcaggcg
actgcgctggcaaccgtgcagcaacttgatccgatctacgttgatgtgacccagtccagc
aacgacttcctgcgcctgaaacaggaactggcgaatggcacgctgaaacaagagaacggc
aaagccaaagtgtcactgatcaccagtgacggcattaagttcccgcaggacggtacgctg
gaattctctgacgttaccgttgatcagaccactgggtctatcaccctacgcgctatcttc
ccgaacccggatcacactctgctgccgggtatgttcgtgcgcgcacgtctggaagaaggg
cttaatccaaacgctattttagtcccgcaacagggcgtaacccgtacgccgcgtggcgat
gccaccgtactggtagttggcgcggatgacaaagtggaaacccgtccgatcgttgcaagc
caggctattggcgataagtggctggtgacagaaggtctgaaagcaggcgatcgcgtagta
ataagtgggctgcagaaagtgcgtcctggtgtccaggtaaaagcacaagaagttaccgct
gataataaccagcaagccgcaagcggtgctcagcctgaacagtccaagtcttaa

DBGET integrated database retrieval system