KEGG   Escherichia coli K-12 MG1655: b0479Help
Entry
b0479             CDS       T00007                                 

Gene name
fsr
Definition
(RefSeq) putative fosmidomycin efflux system protein
  KO
K08223  
MFS transporter, FSR family, fosmidomycin resistance protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Fosmidomycin resistance (Fsr) family [TC:2.A.1.35]
    b0479 (fsr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(503476..504696)
Genome map
AA seq 406 aa AA seqDB search
MAMSEQPQPVAGAAASTTKARTSFGILGAISLSHLLNDMIQSLILAIYPLLQSEFSLTFM
QIGMITLTFQLASSLLQPVVGYWTDKYPMPWSLPIGMCFTLSGLVLLALAGSFGAVLLAA
ALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFGSSLGPLLAAVIIAPYGKGNV
AWFVLAALLAIVVLAQISRWYSAQHRMNKGKPKATIINPLPRNKVVLAVSILLILIFSKY
FYMASISSYYTFYLMQKFGLSIQNAQLHLFAFLFAVAAGTVIGGPVGDKIGRKYVIWGSI
LGVAPFTLILPYASLHWTGVLTVIIGFILASAFSAILVYAQELLPGRIGMVSGLFFGFAF
GMGGLGAAVLGLIADHTSIELVYKICAFLPLLGMLTIFLPDNRHKD
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgagtgaacaaccccagcctgtggcgggcgcggctgcgtcaacgaccaaggcc
cgaacatcgtttggtattttaggtgctatcagcctctcacatctgctgaacgacatgatc
caatcgctgattctggcgatttatccgctgcttcagtcagaattttctctgacatttatg
cagattggcatgataaccctcaccttccagctcgcctcttcgctactgcaaccagtggtc
ggctactggaccgataaatatccgatgccatggtcgttgccaattggcatgtgctttacc
ttaagcggtctggtgctgcttgcgctggcgggcagttttggcgcagttctgctggcggcg
gcgctggtcggtaccggttcatcggtctttcatccggaatcttctcgcgtggcccgtatg
gcttccggcgggcggcatggcctggcgcaatctatctttcaggtcggcggcaactttggc
agttccctgggacccttgctggcggcggtgattatcgcgccttatggcaaaggcaacgtt
gcctggtttgtgcttgcggcactgctggcgatcgtggtgttggcgcaaatcagccgttgg
tactcggcacagcaccgaatgaataaaggaaaacccaaagcgacgattatcaatccactg
ccgcgcaataaagttgtactggcggtcagcattctgttaatcctcattttctcgaaatat
ttctatatggcgagcatcagcagctattacaccttttatctgatgcaaaaattcggatta
tctatccagaatgctcagcttcatctgtttgccttcctgtttgccgttgcggcaggtacg
gtgatcggcgggcctgtaggggataaaattgggcggaaatatgtgatttggggctctatc
ctcggcgttgcgccgtttacgctgattttaccctacgccagcctgcactggacgggggtt
ttaacggtgattattggatttatcctcgcttcggcattctctgccattctggtctacgct
caggagctgcttccaggacgtatcggtatggtttctggactctttttcggttttgctttt
ggcatgggaggtctgggagcggcagttctggggcttatcgccgatcacaccagcatcgag
ttagtctataaaatctgtgctttcctgccactattggggatgttgaccatattcctgcct
gataaccggcataaagactga

DBGET integrated database retrieval system