KEGG   Escherichia coli K-12 MG1655: b0481Help
Entry
b0481             CDS       T00007                                 

Gene name
ybaK
Definition
(RefSeq) Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase
  KO
K03976  
Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase [EC:3.1.1.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     b0481 (ybaK)
Transfer RNA biogenesis [BR:eco03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    b0481 (ybaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(506603..507082)
Genome map
AA seq 159 aa AA seqDB search
MTPAVKLLEKNKISFQIHTYEHDPAETNFGDEVVKKLGLNPDQVYKTLLVAVNGDMKHLA
VAVTPVAGQLDLKKVAKALGAKKVEMADPMVAQRSTGYLVGGISPLGQKKRLPTIIDAPA
QEFATIYVSGGKRGLDIELAAGDLAKILDAKFADIARRD
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgcagttaaattactcgaaaaaaacaagatttcgtttcaaatccatacctac
gagcacgatccggctgaaaccaattttggcgatgaagtcgtcaaaaaattaggtttgaat
ccggatcaggtctacaaaacgctgctggtggcagtgaacggtgatatgaaacaccttgcc
gtggccgttacgccggtcgcaggtcaactggatcttaaaaaagtagcaaaagcgctgggt
gccaagaaagttgagatggccgatccgatggtcgcgcagcgttcgacgggatacctggtt
ggggggattagcccactggggcagaaaaaacgtctgccaacgattatcgacgcccccgca
caagaatttgccactatttatgtttccggcggcaagcgcggactggatatcgaactggcg
gcaggcgatctggcaaagatcctcgatgccaaatttgctgatatcgcccgccgcgattaa

DBGET integrated database retrieval system