KEGG   Escherichia coli K-12 MG1655: b0484Help
Entry
b0484             CDS       T00007                                 

Gene name
copA
Definition
(RefSeq) copper transporter (EC:3.6.3.4)
  KO
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     b0484 (copA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(508875..511379)
Genome map
AA seq 834 aa AA seqDB search
MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVEQADVSITEAHVTGTASAEQLIETIKQAG
YDASVSHPKAKPLAESSIPSEALTAVSEALPAATADDDDSQQLLLSGMSCASCVTRVQNA
LQSVPGVTQARVNLAERTALVMGSASPQDLVQAVEKAGYGAEAIEDDAKRRERQQETAVA
TMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTADNRSLWLVIGLITLAVMVFAGGHFYRS
AWKSLLNGAATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGH
MLEARARQRSSKALEKLLDLTPPTARLVTDEGEKSVPLAEVQPGMLLRLTTGDRVPVDGE
ITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVLFRASAVGSHTTLSRIIRMVR
QAQSSKPEIGQLADKISAVFVPVVVVIALVSAAIWYFFGPAPQIVYTLVIATTVLIIACP
CALGLATPMSIISGVGRAAEFGVLVRDADALQRASTLDTVVFDKTGTLTEGKPQVVAVKT
FADVDEAQALRLAAALEQGSSHPLARAILDKAGDMQLPQVNGFRTLRGLGVSGEAEGHAL
LLGNQALLNEQQVGTKAIEAEITAQASQGATPVLLAVDGKAVALLAVRDPLRSDSVAALQ
RLHKAGYRLVMLTGDNPTTANAIAKEAGIDEVIAGVLPDGKAEAIKHLQSEGRQVAMVGD
GINDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLMGVADALAISRATLHNMKQNLLG
AFIYNSIGIPVAAGILWPFTGTLLNPVVAGAAMALSSITVVSNANRLLRFKPKE
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaactatcgacctgaccctggacggcctgtcctgcggtcactgcgttaaacgc
gtgaaagaaagtcttgaacagcgtccggatgttgagcaggcggatgtgtctatcactgaa
gcgcacgttaccgggactgccagtgcagaacagctgatcgaaaccatcaaacaagcgggt
tatgacgcatctgtaagccacccaaaggctaaaccgctggcggagtcatcaatcccgtcg
gaagcactgacagcggtttctgaggcgcttccggcagcgaccgccgatgacgatgacagc
cagcagttgctgctgagcggcatgagctgcgccagctgtgtcacccgcgtacaaaatgcg
ctgcaaagcgtaccgggcgtcactcaggcacgggtaaacctggcggagcgtactgcgctg
gtgatgggcagtgcctccccacaagatttagtgcaggcggtggaaaaagcgggctacggc
gcggaagcgattgaagatgacgctaaacgccgcgagcgccagcaagaaaccgccgtcgct
acgatgaagcgcttccgctggcaggcaattgtcgcactggcggtgggtatcccggtgatg
gtctgggggatgatcggcgataacatgatggtcaccgctgacaaccgcagcctgtggttg
gttatcggcctgataaccctggcagtgatggttttcgccggcggccatttttaccgcagt
gcatggaaaagcctgctgaacggtgcggcgacgatggatacgctggtggcgctgggtact
ggcgtggcgtggctctattcgatgagcgtcaacctgtggccgcagtggttcccgatggaa
gcgcgacatctttattacgaagccagcgcgatgattatcggtctgatcaatctcggccat
atgctggaagcgcgcgcacgccagcgttcttctaaggcgctggaaaagttactcgattta
accccgccgacggcacgcctggttactgacgaaggtgaaaaaagcgtgcctctggcagaa
gtgcagccaggtatgttgctgcgcctgacgaccggcgatcgcgtgccggtagatggcgag
attacccagggcgaagcatggctggatgaagcgatgctgacgggcgaaccaatcccgcag
caaaaaggcgaaggcgatagcgtccatgccgggacagtggtacaggacggcagtgtgctg
tttcgtgccagtgcggttggcagccatactacgctgtcacgaatcattcgcatggtgcgc
caggcccagagcagcaagccagaaatcggtcagctggcggataaaatctcagccgtattt
gtgccggtagtggtggttattgcgcttgtcagtgcggcaatctggtatttctttggtccg
gcaccgcagattgtctataccctggtgattgccaccacggtactgattattgcctgtccg
tgtgcgctggggctggcgacgccgatgtcgattatttccggcgtcgggcgggcggctgag
tttggcgtgctggtgcgggacgctgacgcgctgcaacgcgccagtacactcgacactgta
gtgttcgataaaaccgggacgctgactgaagggaagccgcaggttgtcgcagtgaaaaca
tttgctgatgttgatgaagcgcaggcattgcgtctggcggcggcactggagcaaggttcc
agccatccgctggcacgagcgatcctcgataaagcaggtgatatgcagctaccgcaggtc
aacggtttccgcacattgcgcgggctgggcgtgagcggtgaagctgaaggtcatgcgtta
ttgctgggcaatcaggcgctgttaaatgagcaacaggttggtaccaaagctatcgaagcg
gagattactgctcaggcatcgcaaggggcaacgcctgtgctgctggcggttgacgggaaa
gcggtagccctgctggcagtacgcgatccgttgcgtagtgatagcgtggcggcgctgcaa
cgcctgcataaagcgggatatcgtctggtgatgttgaccggggataacccaaccaccgcc
aatgcgatcgccaaagaagcagggattgatgaggtgatcgccggggtgctgccggacggt
aaagccgaagcgatcaaacatctgcaaagtgaaggacgtcaggtggcaatggtgggcgac
ggcattaacgacgcgccagcgctggctcaggcggatgtcggcattgcgatgggtggcggc
agtgatgttgccattgaaaccgcggcgattaccctgatgcgccatagcctgatgggcgtt
gcggatgcgctcgctatttcccgcgcaacgctgcacaacatgaagcagaacctgctcggt
gcgtttatctacaacagtatcggtattccggtcgccgccggtattttgtggccgttcact
ggaacactgcttaacccggtagttgccggagcggcaatggcgctctcgtcgattaccgta
gtgagtaacgccaaccggttgctgcggtttaaaccgaaggaataa

DBGET integrated database retrieval system