KEGG   Escherichia coli K-12 MG1655: b0490Help
Entry
b0490             CDS       T00007                                 

Gene name
fetA
Definition
(RefSeq) iron exporter, ATP-binding subunit, ABC transporter FetAB subunit; peroxide resistance protein
  KO
K02068  
putative ABC transport system ATP-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Module
Putative ABC transport system
Brite
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative ABC transporter [MD:M00211] [OT]
    b0490 (fetA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
515919..516596
Genome map
AA seq 225 aa AA seqDB search
MQENSPLLQLQNVGYLAGDAKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPT
SGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFPWQIRNRQPDPAIFLDF
LERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMI
HRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARYELA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaatagtcctttgcttcagctacaaaacgtaggatatctggcgggtgatgcg
aagattcttaataacatcaatttttcgctgcgtgctggcgaatttaagttaattaccggt
ccttctggttgtggcaaaagtacgctgctaaaaatagttgcttcattgatcagcccaacc
agcggaacgttactgtttgaaggtgaggatgtcagcacactaaagccagaaatctaccgc
caacaagtctcttactgcgcccagacaccgacgctgtttggcgatacggtatacgataat
ctgatctttccctggcagatccgtaaccggcagcctgacccagccatttttctcgatttt
ctcgaacgcttcgccttgccggacagcattttgacgaagaatatcgccgagctatctggt
ggtgaaaaacaacgcatctcattgattcgtaacctgcaatttatgccgaaggttttattg
ctggatgaaataaccagtgcgctggatgaaagtaataaacataacgtcaatgagatgatc
catcgttatgtgcgcgagcaaaatattgccgtgctgtgggtgacacacgataaagacgaa
attaatcatgcggataaagtgattacactgcaaccgcatgccggagaaatgcaggaagca
cgctatgaactcgcataa

DBGET integrated database retrieval system