KEGG   Escherichia coli K-12 MG1655: b0490Help
Entry
b0490             CDS       T00007                                 

Gene name
fetA
Definition
(RefSeq) iron export ABC transporter ATPase; peroxide resistance protein
  KO
K02068  putative ABC transport system ATP-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Module
eco_M00211  Putative ABC transport system
Brite
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative ABC transporter [MD:M00211] [OT]
    b0490 (fetA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA Rad17 AAA_29 Adeno_IVa2 AAA_21 AAA_14 AAA_16 AAA_23 NTPase_1 AAA_22 NACHT RsgA_GTPase AAA_25 AAA_5 AAA_18 T2SSE ATPase_2 AAA_11 AAA_30 Mg_chelatase RNA_helicase AAA_28 G-alpha AAA_27 Viral_helicase1 Cytidylate_kin
Motif
Other DBs
NCBI-GeneID: 946990
NCBI-ProteinID: NP_415023
Pasteur: ybbL
RegulonDB: ECK120002874
ECOCYC: G6266
ASAP: ABE-0001703
UniProt: P77279
Position
515919..516596
Genome map
AA seq 225 aa AA seqDB search
MQENSPLLQLQNVGYLAGDAKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPT
SGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFPWQIRNRQPDPAIFLDF
LERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMI
HRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARYELA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaatagtcctttgcttcagctacaaaacgtaggatatctggcgggtgatgcg
aagattcttaataacatcaatttttcgctgcgtgctggcgaatttaagttaattaccggt
ccttctggttgtggcaaaagtacgctgctaaaaatagttgcttcattgatcagcccaacc
agcggaacgttactgtttgaaggtgaggatgtcagcacactaaagccagaaatctaccgc
caacaagtctcttactgcgcccagacaccgacgctgtttggcgatacggtatacgataat
ctgatctttccctggcagatccgtaaccggcagcctgacccagccatttttctcgatttt
ctcgaacgcttcgccttgccggacagcattttgacgaagaatatcgccgagctatctggt
ggtgaaaaacaacgcatctcattgattcgtaacctgcaatttatgccgaaggttttattg
ctggatgaaataaccagtgcgctggatgaaagtaataaacataacgtcaatgagatgatc
catcgttatgtgcgcgagcaaaatattgccgtgctgtgggtgacacacgataaagacgaa
attaatcatgcggataaagtgattacactgcaaccgcatgccggagaaatgcaggaagca
cgctatgaactcgcataa

DBGET integrated database retrieval system