KEGG   Escherichia coli K-12 MG1655: b0496Help
Entry
b0496             CDS       T00007                                 

Gene name
ybbP
Definition
(RefSeq) putative ABC transporter permease
  KO
K02004  
putative ABC transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Module
Putative ABC transport system
Brite
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    b0496 (ybbP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
520416..522830
Genome map
AA seq 804 aa AA seqDB search
MIARWFWREWRSPSLLIVWLALSLAVACVLALGNISDRMEKGLSQQSREFMAGDRALRSS
REVPQAWLEEAQKRGLKVGKQLTFATMTFAGDTPQLANVKAVDDIYPMYGDLQTNPPGLK
PQAGSVLLAPRLMALLNLKTGDTIDVGDATLRIAGEVIQEPDSGFNPFQMAPRLMMNLAD
VDKTGAVQPGSRVTWRYKFGGNENQLDGYEKWLLPQLKPEQRWYGLEQDEGALGRSMERS
QQFLLLSALLTLLLAVAAVAVAMNHYCRSRYDLVAILKTLGAGRAQLRKLIVGQWLMVLT
LSAVTGGAIGLLFENVLMVLLKPVLPAALPPASLWPWLWALGTMTVISLLVGLRPYRLLL
ATQPLRVLRNDVVANVWPLKFYLPIVSVVVVLLLAGLMGGSMLLWAVLAGAVVLALLCGV
LGWMLLNVLRRMTLKSLPLRLAVSRLLRQPWSTLSQLSAFSLSFMLLALLLVLRGDLLDR
WQQQLPPESPNYFLINIATEQVAPLKAFLAEHQIVPESFYPVVRARLTAINDKPTEGNED
EALNRELNLTWQNTRPDHNPIVAGNWPPKADEVSMEEGLAKRLNVALGDTVTFMGDTQEF
RAKVTSLRKVDWESLRPNFYFIFPEGALDGQPQSWLTSFRWENGNGMLTQLNRQFPTISL
LDIGAILKQVGQVLEQVSRALEVMVVLVTACGMLLLLAQVQVGMRQRHQELVVWRTLGAG
KKLLRTTLWCEFAMLGFVSGLVAAIGAETALAVLQAKVFDFPWEPDWRLWIVLPCSGALL
LSLFGGWLGARLVKGKALFRQFAG
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgattgcacgttggttctggcgcgaatggcgttcgccgtcgctattaattgtctggctg
gcgctaagcctggcggtggcctgcgtgctggcgctgggcaatatcagcgatcgcatggag
aagggcttaagccagcaaagccgtgagtttatggcgggcgatcgggcgttgcgcagttca
cgcgaagtgccgcaagcgtggctggaggaagcgcaaaagcgcggcctgaaagtcggcaag
cagctgactttcgccacaatgacctttgcaggcgacacaccgcagctggcgaacgtcaaa
gcggtggatgatatctacccgatgtatggcgatctgcaaactaatccccctggcctgaaa
ccgcaggcgggcagcgtattgctggccccacgcctgatggcactgcttaacctgaaaacg
ggcgacaccattgacgtgggcgatgccaccttgcggattgccggagaagtgattcaggaa
ccggattccggttttaaccccttccagatggctccgcgtctgatgatgaatctggcggat
gtcgataaaaccggagccgtgcagccggggagtcgggtcacctggcgttataaattcggc
ggcaacgagaaccagctcgacggctatgagaaatggttgttacctcagcttaaacccgaa
caacgctggtacggtctggaacaggacgaaggcgcgctggggcgatcgatggaacgctcg
caacagttcctgctgctttcggcgcttctgaccttgctgctggcagtggcagcggtggcg
gtagcgatgaatcattactgtcgcagtcgctacgatctggtggcgatcctcaaaacgctg
ggggcagggcgagcgcaactgcgtaagctaatcgtcggtcagtggttgatggtgctgacg
ctttcagccgttaccggtggggccataggcctgttgttcgaaaacgtgttgatggtgctg
ctcaagcccgttctgcctgctgcactaccgccagccagcctctggccgtggctgtgggcg
cttggcaccatgacggtcatctcgctgctggtggggctacgaccatatcgcttgttgctg
gcaacgcagcctttacgcgtattacgtaatgatgtggtagcgaacgtctggccgctgaag
ttttatctgccgattgtcagtgtggtggttgtgctgctgctcgccggattaatgggtggc
agcatgctgctttgggcggtgctggcgggcgcggtagtactggctttgctgtgcggtgtg
ctgggctggatgctgctgaatgtacttcgccgcatgacgctgaaatcgctgcctctgcgc
ctggcggttagccgcctgttacgtcagccgtggtcaacgttaagtcagctttcggcattt
tcgctctcctttatgctgctggcactgctgctggtgttgcgtggcgatctgctcgaccgc
tggcagcagcagctacctccagaaagcccgaactactttttaattaacatcgccacagaa
caggtagcaccgctaaaagcgttcctcgcggaacatcagatagtcccggaatcgttttat
ccggtggtgcgggcgcggctgacggcgattaacgataagccgacagaaggtaatgaagat
gaggcgcttaaccgcgaactcaatcttacctggcaaaatacgcggcccgatcataatccg
attgtcgccggtaactggccgccaaaagccgatgaagtgtcgatggaagaggggctggcg
aaacgcttaaacgttgccctcggtgataccgtgacttttatgggcgatacccaggagttc
cgcgctaaagtgaccagcctgcgcaaagtggactgggaaagtctgcggcctaatttctat
tttattttccctgaaggggcattagacgggcaaccgcagagctggcttaccagtttccgc
tgggagaatggcaacggcatgttgacacaactcaaccgccagttcccgaccattagcctg
ttagatattggcgcgattttaaaacaggtcggtcaggtgctggagcaggtaagtcgggcg
ctggaagtgatggtggtactggtcaccgcctgcggtatgttgctgttgctggcacaggtg
caggtgggaatgcgtcagcgtcatcaggagctggtggtgtggcgcacactcggtgcgggg
aaaaaactgctgcgtaccacgttgtggtgtgagttcgccatgcttgggtttgtttccggc
ctggtggccgcaattggtgcggaaacggcgctggcagtgttgcaggcgaaagtgtttgat
tttccgtgggagccagactggcgattgtggattgttctgccgtgcagcggagcgctgctg
ctgtcgcttttcggcggctggctgggtgcgcgactggttaagggtaaggcgctgttcagg
cagtttgcggggtga

DBGET integrated database retrieval system