KEGG   Escherichia coli K-12 MG1655: b0506Help
Entry
b0506             CDS       T00007                                 

Gene name
allR
Definition
(RefSeq) transcriptional repressor of all and gcl operons; glyoxylate-induced
  KO
K10973  
IclR family transcriptional regulator, negative regulator of allantoin and glyoxylate utilization operons
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   IclR family
    b0506 (allR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
533011..533826
Genome map
AA seq 271 aa AA seqDB search
MTEVRRRGRPGQAEPVAQKGAQALERGIAILQYLEKSGGSSSVSDISLNLDLPLSTTFRL
LKVLQAADFVYQDSQLGWWHIGLGVFNVGAAYIHNRDVLSVAGPFMRRLMLLSGETVNVA
IRNGNEAVLIGQLECKSMVRMCAPLGSRLPLHASGAGKALLYPLAEEELMSIILQTGLQQ
FTPTTLVDMPTLLKDLEQARELGYTVDKEEHVVGLNCIASAIYDDVGSVVAAISISGPSS
RLTEDRFVSQGELVRDTARDISTALGLKAHP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagttagacggcgcggcaggccaggacaggcggagcctgtggcacagaagggc
gcacaggcgttagagcggggaattgcgattctgcaatatttggaaaaaagtgggggaagt
tcgtcggttagcgatatttctctcaatctggatttgccgctctccacgacctttcgcttg
ctgaaggttttacaggcagcggattttgtctatcaggacagtcaattaggctggtggcat
ataggattaggtgtctttaacgtcggtgcggcgtacatccataaccgcgatgtcctctcc
gtcgccgggccgtttatgcgccgcctgatgttactttccggcgaaacggtcaatgtcgcg
atccgtaacggcaatgaagcggtattaattggtcagttagagtgtaaatcgatggtcagg
atgtgtgcgccactgggcagtcgtctgccactgcatgcttccggtgcgggcaaagcgctg
ctttatccgctggcggaagaggagttgatgagcatcattctgcaaaccggtttgcagcag
tttacgccaactacgcttgtggatatgcccaccttgctgaaggacctggaacaagcgcgt
gaactgggctataccgtagataaagaagagcatgttgtaggtctgaattgcatagcttca
gcaatttacgatgatgtcggtagtgttgttgccgctatctccatctccgggccttcatca
agactgacagaagatcgttttgtcagtcagggtgagctggtcagagacaccgcccgcgat
atcagcacggcgttgggactgaaagcacatccataa

DBGET integrated database retrieval system