KEGG   Escherichia coli K-12 MG1655: b0508Help
Entry
b0508             CDS       T00007                                 

Gene name
hyi
Definition
(RefSeq) hydroxypyruvate isomerase (EC:5.3.1.22)
  KO
K01816  
hydroxypyruvate isomerase [EC:5.3.1.22]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    b0508 (hyi)
Enzymes [BR:eco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.22  hydroxypyruvate isomerase
     b0508 (hyi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
535710..536486
Genome map
AA seq 258 aa AA seqDB search
MLRFSANLSMLFGEYDFLARFEKAAQCGFRGVEFMFPYDYDIEELKHVLASNKLEHTLHN
LPAGDWAAGERGIACIPGREEEFRDGVAAAIRYARALGNKKINCLVGKTPAGFSSEQIHA
TLVENLRYAANMLMKEDILLLIEPINHFDIPGFHLTGTRQALKLIDDVGCCNLKIQYDIY
HMQRMEGELTNTMTQWADKIGHLQIADNPHRGEPGTGEINYDYLFKVIENSDYNGWVGCE
YKPQTTTEAGLRWMDPYR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttacgtttctctgctaatttatcgatgttatttggagaatatgattttctcgcccgt
tttgagaaagctgcgcagtgtggttttcgcggcgttgaatttatgtttccttatgactac
gacattgaagaattaaaacatgtgctggcgagtaataaactcgaacatacgctgcacaat
ttaccggcgggtgactgggcggcgggggagcgcggtattgcctgtattcctggccgtgaa
gaagagtttcgggatggcgtagcagcagcgattcgttatgcccgtgcgctgggtaataaa
aaaattaactgtctggtcggtaaaacgccggctggtttcagcagtgaacagattcacgca
acgcttgtagaaaacctgcgttatgccgcgaatatgctgatgaaagaagatattttatta
ctgattgaacctattaaccattttgatattcctggtttccatctcaccggaactcggcag
gcgctgaaattgattgatgatgttggttgctgcaatttgaaaattcagtatgacatttat
catatgcagcggatggaaggtgaattaaccaacaccatgactcagtgggctgataaaatt
ggtcacctgcaaattgccgataatccgcatcgcggcgaaccgggaaccggagaaattaat
tatgattatctctttaaggtaatcgaaaattctgactacaacggttgggttgggtgtgaa
tataaaccccaaaccaccacggaagccggtttacgctggatggatccgtaccgttaa

DBGET integrated database retrieval system