KEGG   Escherichia coli K-12 MG1655: b0511Help
Entry
b0511             CDS       T00007                                 

Gene name
ybbW
Definition
(RefSeq) putative allantoin transporter
  KO
K10975  
allantoin permease
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b0511 (ybbW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
537633..539087
Genome map
AA seq 484 aa AA seqDB search
MEHQRKLFQQRGYSEDLLPKTQSQRTWKTFNYFTLWMGSVHNVPNYVMVGGFFILGLSTF
SIMLAIILSAFFIAAVMVLNGAAGSKYGVPFAMILRASYGVRGALFPGLLRGGIAAIMWF
GLQCYAGSLACLILIGKIWPGFLTLGGDFTLLGLSLPGLITFLIFWLVNVGIGFGGGKVL
NKFTAILNPCIYIVFGGMAIWAISLVGIGPIFDYIPSGIQKAENGGFLFLVVINAVVAVW
AAPAVSASDFTQNAHSFREQALGQTLGLVVAYILFAVAGVCIIAGASIHYGADTWNVLDI
VQRWDSLFASFFAVLVILMTTISTNATGNIIPAGYQIAAIAPTKLTYKNGVLIASIISLL
ICPWKLMENQDSIYLFLDIIGGMLGPVIGVMMAHYFVVMRGQINLDELYTAPGDYKYYDN
GFNLTAFSVTLVAVILSLGGKFIHFMEPLSRVSWFVGVIVAFAAYALLKKRTTAEKTGEQ
KTIG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcagagaaaactattccagcaacgcggctatagcgaagatctattgccgaaa
acgcaaagccagcggacctggaaaacatttaactattttaccttatggatgggttcggtt
cataacgttcccaattatgtgatggtcggcggcttttttattctcggcttgtctaccttt
agtattatgctggcaattatcctcagcgcctttttcattgccgcggtaatggtattaaac
ggtgctgcgggcagtaaatacggtgtgccttttgccatgatcctgcgtgcttcttacggt
gtacgtggtgcactgtttcccggattattaaggggcggaattgccgccatcatgtggttt
ggtttgcaatgttacgcggggtcactggcctgcttgattctgattggcaaaatctggccg
ggatttttaactctcggtggtgatttcactctgttaggcctttctctaccgggcttaatt
actttcttaatcttctggctggtcaacgttggtataggttttggcggtggcaaagtttta
aataaattcactgccattcttaacccgtgcatctatatcgttttcggcggtatggcgatt
tgggcgatttcactggtcgggatcggtccaatctttgactacattccgagcggtattcag
aaagcagaaaacggtggcttcctgttcctggtggtgattaacgcggtagttgcggtctgg
gcggcaccggcggtgagcgcatccgactttacgcaaaacgcccactcgtttcgtgagcag
gcgctggggcaaacgctgggtttagttgtggcctatattctgtttgcggtcgccggggta
tgtattattgccggagccagtattcactacggcgctgatacctggaacgtgctggatatt
gttcagcgttgggacagcctgttcgcctcgttctttgcggtactggttattctgatgaca
actatctccactaacgcgaccggtaatattattccagccggttatcagattgccgccatt
gcaccgacaaaactgacctataaaaacggcgtactgattgccagtattatcagcttgctg
atctgcccgtggaaattaatggaaaatcaggacagcatttatcttttcctcgatattatc
ggcggaatgcttggtccggtaattggtgtcatgatggcgcattattttgtggtgatgcgc
ggacaaattaatcttgatgaactgtataccgcacctggcgattataaatattacgataac
ggttttaacctcactgcgttttcagtaactctggtggccgttattttatctcttggcggt
aagtttattcactttatggaaccgttatcgcgtgtttcatggtttgtcggcgtcatcgtc
gcctttgcggcctacgccttattaaagaaacgtacaacagcagaaaaaacaggagagcaa
aaaaccataggttaa

DBGET integrated database retrieval system