KEGG   Escherichia coli K-12 MG1655: b0543Help
Entry
b0543             CDS       T00007                                 

Gene name
emrE
Definition
(RefSeq) DLP12 prophage; multidrug resistance protein
  KO
K03297  
small multidrug resistance pump
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b0543 (emrE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
568315..568647
Genome map
AA seq 110 aa AA seqDB search
MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAY
AIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLSRSTPH
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaacccttatatttatcttggtggtgcaatacttgcagaggtcattggtacaacctta
atgaagttttcagaaggttttacacggttatggccatctgttggtacaattatttgttat
tgtgcatcattctggttattagctcagacgctggcttatattcctacagggattgcttat
gctatctggtcaggagtcggtattgtcctgattagcttactgtcatggggatttttcggc
caacggctggacctgccagccattataggcatgatgttgatttgtgccggtgtgttgatt
attaatttattgtcacgaagcacaccacattaa

DBGET integrated database retrieval system