KEGG   Escherichia coli K-12 MG1655: b0556Help
Entry
b0556             CDS       T00007                                 

Gene name
rzpD
Definition
(RefSeq) DLP12 prophage; putative murein endopeptidase
  KO
K14744  
prophage endopeptidase [EC:3.4.-.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     b0556 (rzpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
578107..578568
Genome map
AA seq 153 aa AA seqDB search
MSRVTAIISALIICIIVSLSWAVNHYRDNAIAYKVQRDKNARELKLANAAITDMQMRQRD
VAALDAKYTKELADAKAENDALRDDVAAGRRRLHIKAVCQSVREATTASGVDNAASPRLA
DTAERDYFTLRERLITMQKQLEGTQKYINEQCR
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagagtaaccgcgattatatccgctctgattatctgcatcatcgtcagcctgtca
tgggcggtcaatcattaccgtgataacgcaatcgcctacaaagtccagcgcgacaaaaat
gccagagaactgaagctagcgaacgcggcaattactgacatgcagatgcgtcagcgtgat
gttgctgcgctcgatgcaaaatacacgaaggagttagctgatgcgaaagctgaaaatgat
gctctgcgtgatgatgttgccgctggtcgtcgtcggttgcacatcaaagcagtctgtcag
tcagtgcgtgaagccaccacggcctccggcgtggataatgcagcctccccccgactggca
gacaccgctgaacgggattatttcaccctcagagagaggctgatcactatgcaaaaacaa
ctggaaggaacccagaagtatattaatgagcagtgcagatag

DBGET integrated database retrieval system