KEGG   Escherichia coli K-12 MG1655: b0560Help
Entry
b0560             CDS       T00007                                 

Gene name
nohD
Definition
(RefSeq) DLP12 prophage; DNA packaging protein
  KO
K22014  terminase small subunit
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_Nu1 HTH_17 MerR MerR_1
Motif
Other DBs
NCBI-GeneID: 945172
NCBI-ProteinID: NP_415092
Pasteur: nohB
RegulonDB: ECK120001582
ASAP: ABE-0001915
UniProt: P31062
Position
580834..581379
Genome map
AA seq 181 aa AA seqDB search
MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENE
KLRREVEELLQASETDLQPGTIEYERHRLTRAQADAQELKNARDSAEVVETAFCTFVLSR
IAGEIASILDGIPLSVQRRFPELENRHVDFLKRDIIKAMNKAAALDELIPGLLSEYIEQS
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcaacaaaaagcagctggctgacattttcggtgcgagtatccgtaccattcag
aactggcaggaacagggaatgcccgttctgcgaggcggtggcaagggtaatgaggtgctt
tatgactctgccgccgtcataaaatggtatgccgaaagggatgctgaaattgagaacgaa
aagctgcgccgggaggttgaagaactgctgcaggccagcgagacagatctccagccaggg
actattgagtacgaacgccatcgacttacgcgtgcgcaggccgatgcacaggagctgaaa
aatgccagagactccgctgaagtggtggaaaccgcattctgtactttcgtgctgtcgcgg
atcgcaggtgaaattgccagtattctcgacgggatccccctgtcggtgcagcggcgtttt
ccggaactggaaaaccgacatgttgatttcctgaaacgggatatcatcaaagccatgaac
aaagcagccgcgctggatgaactgataccggggttgctgagtgaatatatcgaacagtca
ggttaa

DBGET integrated database retrieval system