KEGG   Escherichia coli K-12 MG1655: b0560Help
Entry
b0560             CDS       T00007                                 

Gene name
nohD
Definition
(RefSeq) DLP12 prophage; DNA packaging protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ASAP: 
UniProt: 
Position
580834..581379
Genome map
AA seq 181 aa AA seqDB search
MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENE
KLRREVEELLQASETDLQPGTIEYERHRLTRAQADAQELKNARDSAEVVETAFCTFVLSR
IAGEIASILDGIPLSVQRRFPELENRHVDFLKRDIIKAMNKAAALDELIPGLLSEYIEQS
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcaacaaaaagcagctggctgacattttcggtgcgagtatccgtaccattcag
aactggcaggaacagggaatgcccgttctgcgaggcggtggcaagggtaatgaggtgctt
tatgactctgccgccgtcataaaatggtatgccgaaagggatgctgaaattgagaacgaa
aagctgcgccgggaggttgaagaactgctgcaggccagcgagacagatctccagccaggg
actattgagtacgaacgccatcgacttacgcgtgcgcaggccgatgcacaggagctgaaa
aatgccagagactccgctgaagtggtggaaaccgcattctgtactttcgtgctgtcgcgg
atcgcaggtgaaattgccagtattctcgacgggatccccctgtcggtgcagcggcgtttt
ccggaactggaaaaccgacatgttgatttcctgaaacgggatatcatcaaagccatgaac
aaagcagccgcgctggatgaactgataccggggttgctgagtgaatatatcgaacagtca
ggttaa

DBGET integrated database retrieval system