KEGG   Escherichia coli K-12 MG1655: b0565Help
Entry
b0565             CDS       T00007                                 

Gene name
ompT
Definition
(RefSeq) DLP12 prophage; outer membrane protease VII (outer membrane protein 3b) (EC:3.4.23.49)
  KO
K01355  
omptin [EC:3.4.23.49]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.49  omptin
     b0565 (ompT)
Peptidases [BR:eco01002]
 Aspartic Peptidases
  Family A26: omptin family
   b0565 (ompT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(584680..585633)
Genome map
AA seq 317 aa AA seqDB search
MRAKLLGIVLTTPIAISSFASTETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVS
QLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESR
HPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDI
GSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVESSDNDEHYDPGKRIT
YRSKVKDQNYYSVAVNAGYYVTPNAKVYVEGAWNRVTNKKGNTSLYDHNNNTSDYSKNGA
GIENYNFITTAGLKYTF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgaaacttctgggaatagtcctgacaacccctattgcgatcagctcttttgct
tctaccgagactttatcgtttactcctgacaacataaatgcggacattagtcttggaact
ctgagcggaaaaacaaaagagcgtgtttatctagccgaagaaggaggccgaaaagtcagt
caactcgactggaaattcaataacgctgcaattattaaaggtgcaattaattgggatttg
atgccccagatatctatcggggctgctggctggacaactctcggcagccgaggtggcaat
atggtcgatcaggactggatggattccagtaaccccggaacctggacggatgaaagtaga
caccctgatacacaactcaattatgccaacgaatttgatctgaatatcaaaggctggctc
ctcaacgaacccaattaccgcctgggactcatggccggatatcaggaaagccgttatagc
tttacagccagaggtggttcctatatctacagttctgaggagggattcagagatgatatc
ggctccttcccgaatggagaaagagcaatcggctacaaacaacgttttaaaatgccctac
attggcttgactggaagttatcgttatgaagattttgaactcggtggcacatttaaatac
agcggctgggtggaatcatctgataacgatgaacactatgacccgggaaaaagaatcact
tatcgcagtaaggtcaaagaccaaaattactattctgttgcagtcaatgcaggttattac
gtcacacctaacgcaaaagtttatgttgaaggcgcatggaatcgggttacgaataaaaaa
ggtaatacttcactttatgatcacaataataacacttcagactacagcaaaaatggagca
ggtatagaaaactataacttcatcactactgctggtcttaagtacacattttaa

DBGET integrated database retrieval system