KEGG   Escherichia coli K-12 MG1655: b0572Help
Entry
b0572             CDS       T00007                                 

Gene name
cusC
Definition
(RefSeq) copper/silver efflux system, outer membrane component
  KO
K07796  
outer membrane protein, Cu(I)/Ag(I) efflux system
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b0572 (cusC)
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b0572 (cusC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
595600..596973
Genome map
AA seq 457 aa AA seqDB search
MSPCKLLPFCVALALTGCSLAPDYQRPAMPVPQQFSLSQNGLVNAADNYQNAGWRTFFVD
NQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGNTAT
TREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLAY
AQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQANN
ALQLLLGSYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANANIGAA
RAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIAEIRQQ
QSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHGAVSYL
EVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtctccttgtaaacttctgccattttgtgtggcccttgcgctaaccggttgttcactg
gcaccggattatcagcgtccggcaatgcccgtgccgcagcagttctcactcagccagaac
ggcctggttaacgcagcagataactatcagaacgcgggctggcgcaccttttttgttgat
aatcaggtgaagacgctgattagcgaggcgctggtgaataatcgggatttgcgcatggcg
acgctgaaagtgcaggaggcacgggcgcaatatcgtctgaccgatgccgaccgctaccca
cagctcaatggcgagggcagcggcagctggagcggtaatcttaaagggaataccgccacg
acacgggagttttcgaccggccttaacgccagctttgacctcgattttttcggtcgctta
aagaacatgagcgaagccgagcgacaaaattatttagccactgaggaagctcagcgcgcg
gtgcatattctgctggtttctaatgtcgcgcaaagctatttcaatcagcaactggcgtat
gcgcaattgcaaatagccgaagaaacgctgcgtaattatcagcagtcatatgcgtttgtc
gaaaaacaactgttgacaggtagcagtaatgttctggcgctggaacaggctcgcggggtg
atagaaagtacccgcagcgacatcgctaaacgtcagggggaactggcgcaggcgaataat
gcattgcaactgttgctgggaagctacggcaagctgccgcaagcgcagacagtaaacagc
gacagcctgcaaagcgttaaattaccggcgggattgtcgtcgcaaatcttattgcagcgc
ccggatattatggaagctgaacacgcgttaatggcggctaatgccaatattggcgctgca
cgcgcggcattttttccgtctataagcctgaccagcggaatatcgaccgccagtagcgat
ctatcgtcattatttaacgccagcagcgggatgtggaattttatacccaaaattgagatc
cccatttttaatgccggacgcaaccaggccaatctggatatcgccgaaattcgccagcag
cagtcggtggtgaattatgaacagaaaatccagaacgcctttaaagaagtggcagatgcg
ctggcattacgtcaaagcctgaacgatcaaattagcgcccagcagcgttatctggcatcg
ctgcaaattactttgcaacgggcgcgggcattatatcagcacggcgcagtaagttatctg
gaagtgctggatgccgagcgttctttatttgcaacccgacaaactttacttgatctgaat
tatgcccgtcaggttaacgaaatttctttgtataccgcacttggtggcggttga

DBGET integrated database retrieval system