KEGG   Escherichia coli K-12 MG1655: b0573Help
Entry
b0573             CDS       T00007                                 

Gene name
cusF
Definition
(RefSeq) periplasmic copper- and silver-binding protein
  KO
K07810  
Cu(I)/Ag(I) efflux system periplasmic protein CusF
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b0573 (cusF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
597131..597463
Genome map
AA seq 110 aa AA seqDB search
MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGVVKGIDLESKKITIHHDP
IAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcactgcaagtcgcaatgttcagtctgtttaccgttattggctttaatgcc
caggctaacgaacatcatcatgaaaccatgagcgaagcacaaccacaggttattagcgcc
actggcgtggtaaagggtatcgatctggaaagcaaaaaaatcaccatccatcacgatccg
attgctgccgtgaactggccggagatgaccatgcgctttaccatcaccccgcagacgaaa
atgagtgaaattaaaaccggcgacaaagtggcgtttaattttgtccagcagggcaacctt
tctttattacaggatattaaagtcagccagtaa

DBGET integrated database retrieval system