KEGG   Escherichia coli K-12 MG1655: b0577Help
Entry
b0577             CDS       T00007                                 

Gene name
ybdG
Definition
(RefSeq) mechanosensitive channel protein, miniconductance
  KO
K16053  
miniconductance mechanosensitive channel
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b0577 (ybdG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(603416..604663)
Genome map
AA seq 415 aa AA seqDB search
MQDLISQVEDLAGIEIDHTTSMVMIFGIIFLTAVVVHIILHWVVLRTFEKRAIASSRLWL
QIITQNKLFHRLAFTLQGIIVNIQAVFWLQKGTEAADILTTCAQLWIMMYALLSVFSLLD
VILNLAQKFPAASQLPLKGIFQGIKLIGAILVGILMISLLIGQSPAILISGLGAMAAVLM
LVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGAVIDIGLTTVKVRNWDNTITTIP
TWSLVSDSFKNWSGMSASGGRRIKRSISIDVTSIRFLDEDEMQRLNKAHLLKPYLTSRHQ
EINEWNRQQGSTESVLNLRRMTNIGTFRAYLNEYLRNHPRIRKDMTLMVRQLAPGDNGLP
LEIYAFTNTVVWLEYESIQADIFDHIFAIVEEFGLRLHQSPTGNDIRSLAGAFKQ
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatttaatatcccaggttgaagatttagcgggtattgagatcgatcacaccacc
tcgatggtgatgattttcggtattatttttctgaccgccgtcgtggtgcatattattttg
cattgggtggtactgcggaccttcgaaaaacgtgccatcgccagttcacggctttggttg
caaatcattacccagaataaactcttccaccgtttagcttttaccctgcaggggattatc
gtcaatattcaggcggtattctggctgcaaaaaggcaccgaagcggcagatattctgact
acctgcgcgcagttgtggatcatgatgtatgcgctgctttcagtcttctcgttgctggat
gttattttgaatctggcgcagaaattcccggcagcatctcagttaccgctgaaagggata
tttcaggggattaaactgatcggcgcgattctggtcggcattttgatgatctcgctgctg
attggtcagtcgccagcgattctgatcagcggtcttggtgcaatggctgccgtgctgatg
ttggtatttaaagatccgattcttggtctggtggcaggtattcagctttccgcgaacgat
atgctgaaactgggcgactggctggagatgccgaaatacggcgcggatggcgcggtgatc
gatattgggttaaccaccgtcaaagtgcgtaactgggacaataccattaccactattccc
acctggtctctggtttctgactcctttaaaaactggagcgggatgtcagcatctggcggg
cgacgtattaagcgcagtatcagtattgatgtcaccagtattcgttttcttgatgaagac
gaaatgcaacgtctgaataaagcgcatttgttaaagccttatttaaccagccgccatcag
gaaattaatgagtggaatcgccagcaaggttctacggagtcggtattaaatctgcgccga
atgaccaatattggaacctttcgtgcctatctgaacgaatatctgcgtaaccatccgcgg
attcgtaaagatatgaccttaatggtacgccaactggctccaggtgataacggtttaccg
ctcgagatctacgcgtttactaacaccgtggtgtggctggaatatgaaagcattcaggct
gatatattcgatcacatatttgcgattgtcgaagagtttggtctgcgacttcatcagtcg
ccaaccggcaatgatattcgctctctggcgggtgcatttaagcagtaa

DBGET integrated database retrieval system