KEGG   Escherichia coli K-12 MG1655: b0578Help
Entry
b0578             CDS       T00007                                 

Gene name
nfsB
Definition
(RefSeq) dihydropteridine reductase, NAD(P)H-dependent, oxygen-insensitive (EC:1.5.1.34)
  KO
K10679  
nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    b0578 (nfsB)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     b0578 (nfsB)
  1.-  
   1.-.-  
    1.-.-.-  
     b0578 (nfsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(604771..605424)
Genome map
AA seq 217 aa AA seqDB search
MDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARV
AKSAAGNYVFNERKMLDASHVVVFCAKTAMDDVWLKLVVDQEDADGRFATPEAKAANDKG
RKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKE
KGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatatcatttctgtcgccttaaagcgtcattccactaaggcatttgatgccagcaaa
aaacttaccccggaacaggccgagcagatcaaaacgctactgcaatacagcccatccagc
accaactcccagccgtggcattttattgttgccagcacggaagaaggtaaagcgcgtgtt
gccaaatccgctgccggtaattacgtgttcaacgagcgtaaaatgcttgatgcctcgcac
gtcgtggtgttctgtgcaaaaaccgcgatggacgatgtctggctgaagctggttgttgac
caggaagatgccgatggccgctttgccacgccggaagcgaaagccgcgaacgataaaggt
cgcaagttcttcgctgatatgcaccgtaaagatctgcatgatgatgcagagtggatggca
aaacaggtttatctcaacgtcggtaacttcctgctcggcgtggcggctctgggtctggac
gcggtacccatcgaaggttttgacgccgccatcctcgatgcagaatttggtctgaaagag
aaaggctacaccagtctggtggttgttccggtaggtcatcacagcgttgaagattttaac
gctacgctgccgaaatctcgtctgccgcaaaacatcaccttaaccgaagtgtaa

DBGET integrated database retrieval system