KEGG   Escherichia coli K-12 MG1655: b0579Help
Entry
b0579             CDS       T00007                                 

Gene name
ybdF
Definition
(RefSeq) DUF419 family protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YjbR
Motif
Other DBs
NCBI-GeneID: 948302
NCBI-ProteinID: NP_415111
Pasteur: ybdF
RegulonDB: ECK120002932
ECOCYC: G6324
ASAP: ABE-0001986
UniProt: P0AAT2
Position
complement(605518..605886)
Genome map
AA seq 122 aa AA seqDB search
MDKQSLHETAKRLALELPFVELCWPFGPEFDVFKIGGKIFMLSSELRGVPFINLKSDPQK
SLLNQQIYPSIKPGYHMNKKHWISVYPGEEISEALLRDLINDSWNLVVDGLAKRDQKRVR
PG
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggataagcaatcactgcacgaaacggcgaaacgcctggcccttgagttaccctttgtc
gagctttgctggccttttggcccggagttcgatgtttttaaaattggcggcaagattttt
atgctgtcgtcggagctacgcggcgtcccctttatcaatctgaagtccgatccacaaaaa
tccctgttaaatcagcaaatatacccaagcattaagccagggtatcacatgaataaaaag
cactggatttcagtgtatcccggcgaagaaatctccgaagcgttacttcgcgatctgatc
aacgattcgtggaatctggtggttgatggtctggctaaacgcgatcaaaaaagagtgcgt
ccaggctaa

DBGET integrated database retrieval system