KEGG   Escherichia coli K-12 MG1655: b0584Help
Entry
b0584             CDS       T00007                                 

Gene name
fepA
Definition
(RefSeq) iron-enterobactin outer membrane transporter
  KO
K19611  
ferric enterobactin receptor
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b0584 (fepA)
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b0584 (fepA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(610254..612494)
Genome map
AA seq 746 aa AA seqDB search
MNKKIHSLALLVNLGIYGVAQAQEPTDTPVSHDDTIVVTAAEQNLQAPGVSTITADEIRK
NPVARDVSKIIRTMPGVNLTGNSTSGQRGNNRQIDIRGMGPENTLILIDGKPVSSRNSVR
QGWRGERDTRGDTSWVPPEMIERIEVLRGPAAARYGNGAAGGVVNIITKKGSGEWHGSWD
AYFNAPEHKEEGATKRTNFSLTGPLGDEFSFRLYGNLDKTQADAWDINQGHQSARAGTYA
TTLPAGREGVINKDINGVVRWDFAPLQSLELEAGYSRQGNLYAGDTQNTNSDSYTRSKYG
DETNRLYRQNYALTWNGGWDNGVTTSNWVQYEHTRNSRIPEGLAGGTEGKFNEKATQDFV
DIDLDDVMLHSEVNLPIDFLVNQTLTLGTEWNQQRMKDLSSNTQALTGTNTGGAIDGVST
TDRSPYSKAEIFSLFAENNMELTDSTIVTPGLRFDHHSIVGNNWSPALNISQGLGDDFTL
KMGIARAYKAPSLYQTNPNYILYSKGQGCYASAGGCYLQGNDDLKAETSINKEIGLEFKR
DGWLAGVTWFRNDYRNKIEAGYVAVGQNAVGTDLYQWDNVPKAVVEGLEGSLNVPVSETV
MWTNNITYMLKSENKTTGDRLSIIPEYTLNSTLSWQAREDLSMQTTFTWYGKQQPKKYNY
KGQPAVGPETKEISPYSIVGLSATWDVTKNVSLTGGVDNLFDKRLWRAGNAQTTGDLAGA
NYIAGAGAYTYNEPGRTWYMSVNTHF
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaagattcattccctggccttgttggtcaatctggggatttatggggtagcg
caggcacaagagccgaccgatactcctgtttcacatgacgatactattgtcgttaccgcc
gccgagcagaacttacaggcgcctggcgtttcgaccatcaccgcagatgaaatccgcaaa
aacccggttgcccgcgatgtgtcgaagatcatccgtaccatgccaggcgttaacctgacc
ggtaactccaccagtggtcagcgtgggaataaccgacagattgatattcgcggtatgggt
ccggaaaacacgctgattttgattgacggcaagccggtaagcagccgtaactcggtgcgt
cagggctggcgtggcgagcgcgatacccgtggtgatacttcctgggtgccacctgaaatg
attgaacgtattgaagttctgcgtggtccggcagctgcgcgttatggcaacggcgcggcg
ggcggcgtggttaacatcattaccaaaaaaggcagcggcgagtggcacggctcctgggac
gcatatttcaatgcgccagaacataaagaggaaggtgccaccaaacgcactaactttagc
ctgaccggtccgctgggcgacgaattcagcttccgtttgtatggcaacctcgacaaaacc
caggctgacgcgtgggatatcaaccagggccatcagtccgcgcgtgccggaacgtatgcc
acgacgttaccagccgggcgcgaaggggtaatcaacaaagatattaatggcgtggtgcgc
tgggatttcgcgccattgcaatcgctggaactggaagcaggttacagccgccagggtaac
ctgtatgcgggcgacacccagaataccaactccgattcctatacccgctcgaaatatggc
gatgaaaccaaccgtctgtatcgccagaactacgcgctgacctggaacggtggctgggat
aacggcgtgaccaccagcaactgggtgcagtacgaacacacccgtaactcgcgtattccg
gaaggtctggcgggcggtaccgaagggaaatttaacgaaaaagcgacacaggatttcgtc
gatatcgatcttgatgacgtgatgctgcacagcgaagttaacctgccgattgatttcctc
gttaaccagacgctgacgctgggtacggagtggaatcagcaacggatgaaggacttaagt
tccaacacccaggcactgaccggaacgaataccggtggcgctattgatggcgtgagtacc
accgaccgtagcccgtattcaaaagcagaaattttctcgctgtttgccgaaaacaacatg
gagctgactgacagcaccatcgtaacgccggggctgcgtttcgatcatcacagtattgtc
ggcaataactggagcccggcgctgaacatatcgcaaggtttaggcgatgacttcacgctg
aaaatgggcatcgcccgtgcttataaagcgccgagcctgtaccagactaacccgaactac
attctctacagtaaaggtcagggttgctatgccagcgcgggcggctgctatctgcaaggt
aacgatgacctgaaagcagaaaccagcatcaacaaagagattggtctggagttcaaacgc
gacgggtggctggcgggcgtcacctggttccgtaacgattatcgcaataagattgaagcg
ggctatgtggctgtagggcaaaacgcagtcggcaccgatctctatcagtgggataacgtg
ccgaaagcggtggttgaaggtctggaaggatcgttaaacgtaccggttagcgaaacggtg
atgtggaccaataacatcacttatatgctgaagagtgaaaacaaaaccacgggcgaccgt
ttgtcgatcatcccggagtatacgttgaactcaacgctgagctggcaggcacgggaagat
ttgtcgatgcaaacgaccttcacctggtacggcaagcagcagccgaagaagtacaactat
aaaggtcagccagcggttggaccggaaaccaaagaaattagtccttacagcattgttggc
ctgagcgcgacctgggatgtgacgaagaatgtcagtctgaccggcggcgtggacaatctg
ttcgacaaacgtttgtggcgtgcgggtaatgcccagaccacgggcgatttggcaggggcc
aactatatcgccggtgccggggcgtatacctataacgagccgggacgtacgtggtatatg
agcgtaaacacccacttctga

DBGET integrated database retrieval system