KEGG   Escherichia coli K-12 MG1655: b0611Help
Entry
b0611             CDS       T00007                                 

Gene name
rna
Definition
(RefSeq) ribonuclease I
  KO
K01169  
ribonuclease I (enterobacter ribonuclease) [EC:3.1.27.6]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.6  Enterobacter ribonuclease
     b0611 (rna)
Transfer RNA biogenesis [BR:eco03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    b0611 (rna)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(644197..645003)
Genome map
AA seq 268 aa AA seqDB search
MKAFWRNAALLAVSLLPFSSANALALQAKQYGDFDRYVLALSWQTGFCQSQHDRNRNERD
ECRLQTETTNKADFLTVHGLWPGLPKSVAARGVDERRWMRFGCATRPIPNLPEARASRMC
SSPETGLSLETAAKLSEVMPGAGGRSCLERYEYAKHGACFGFDPDAYFGTMVRLNQEIKE
SEAGKFLADNYGKTVSRRDFDAAFAKSWGKENVKAVKLTCQGNPAYLTEIQISIKADAIN
APLSANSFLPQPHPGNCGKTFVIDKAGY
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattctggcgtaacgccgcgttgctcgcggtttctctgcttcccttctcttct
gccaacgccttagcgttgcaggcaaaacagtatggcgattttgatcgctatgtcctggcc
ctctcctggcaaaccggattttgccagagtcaacacgatcgaaatcgtaacgaacgagat
gaatgtcgcctgcaaaccgaaacgaccaacaaagctgattttctgaccgtacatggtctg
tggccaggattgcctaaatcggttgctgcccgtggtgttgatgaacgccgctggatgcgc
ttcggttgcgctactcgcccaatcccgaatctaccagaagcgcgcgccagccgaatgtgt
tcatcgccggaaaccggattatcactggaaacggccgctaaactaagtgaagtcatgcca
ggagctggcggacgttcctgcctggaacgctacgaatatgccaaacacggtgcctgcttt
ggttttgatccggacgcatacttcggtacgatggtacgcctgaatcaagaaattaaagag
agcgaagccggaaaattccttgcggataattacggtaaaacagtgagccgccgtgacttt
gacgccgcctttgccaaaagctggggaaaagagaacgtgaaagcagttaagctaacgtgc
cagggtaaccctgcgtatttgactgaaattcagatctcgatcaaagctgacgccatcaac
gctccgctttctgcaaactcattcttgccacaacctcacccaggtaactgtggcaaaacc
tttgtgattgataaagcgggttattaa

DBGET integrated database retrieval system