KEGG   Escherichia coli K-12 MG1655: b0634Help
Entry
b0634             CDS       T00007                                 

Gene name
mrdB
Definition
(RefSeq) cell wall shape-determining protein
  KO
K05837  
rod shape determining protein RodA
Organism
eco  Escherichia coli K-12 MG1655
Brite
Chromosome [BR:eco03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    b0634 (mrdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(665201..666313)
Genome map
AA seq 370 aa AA seqDB search
MTDNPNKKTFWDKVHLDPTMLLILLALLVYSALVIWSASGQDIGMMERKIGQIAMGLVIM
VVMAQIPPRVYEGWAPYLYIICIILLVAVDAFGAISKGAQRWLDLGIVRFQPSEIAKIAV
PLMVARFINRDVCPPSLKNTGIALVLIFMPTLLVAAQPDLGTSILVALSGLFVLFLSGLS
WRLIGVAVVLVAAFIPILWFFLMHDYQRQRVMMLLDPESDPLGAGYHIIQSKIAIGSGGL
RGKGWLHGTQSQLEFLPERHTDFIFAVLAEELGLVGILILLALYILLIMRGLWIAARAQT
TFGRVMAGGLMLILFVYVFVNIGMVSGILPVVGVPLPLVSYGGSALIVLMAGFGIVMSIH
THRKMLSKSV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgacggataatccgaataaaaaaacattctgggataaagtccatctcgatcccacaatg
ctgctgatcttactggcattgctggtttacagcgccctggttatctggagcgccagcggt
caggatattggcatgatggagcgtaaaatcggccaaatcgcgatgggtctggtcatcatg
gtggtgatggcgcaaattcctccacgcgtttatgaaggctgggccccctatctctatatc
atctgtattattttgctggtggcggtagatgctttcggtgccatctctaaaggtgctcaa
cgctggctggacctcggtattgttcgttttcagccgtcggaaattgccaaaatagccgta
ccactgatggttgcgcgctttatcaaccgcgacgtttgcccgccatcgttgaagaacact
ggcatcgcgctggtgctgatatttatgcccacgctgctggtggctgcacagcctgacctg
ggaacatcaatcctcgttgcgctttccggtctgtttgtactgttcctctctggccttagc
tggcgtctgattggcgtcgcagtagtgctggtagcggcgttcattccgattctgtggttc
ttcctgatgcatgattaccagcgccagcgcgtaatgatgctcctggacccggaatcagac
ccactcggcgcgggctatcacattattcagtctaaaattgctattggctccggcggatta
cgcggcaaaggctggctgcacggcactcagtcacagcttgaatttctccccgaacgccat
actgactttatcttcgcggtactggcggaagagctgggattagtgggcattctgattctg
ctcgctctctacattctgctgatcatgcgcgggctgtggatagccgccagagcgcaaacc
acctttggtcgcgtcatggctggcggcttaatgctgatattattcgtttatgtcttcgta
aatattggtatggtaagcggtattctgccggttgtaggggttccgctcccactggtcagt
tatggaggatcggcgctaattgtgctgatggctgggttcgggattgtaatgtcaatccac
acccacaggaaaatgttgtcgaaaagcgtgtaa

DBGET integrated database retrieval system