KEGG   Escherichia coli K-12 MG1655: b0637Help
Entry
b0637             CDS       T00007                                 

Gene name
rsfS
Definition
(RefSeq) ribosomal silencing factor
  KO
K09710  ribosome-associated protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Ribosome biogenesis [BR:eco03009]
 Prokaryotic Type
  Other maturation factors
   b0637 (rsfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RsfS
Motif
Other DBs
NCBI-GeneID: 945237
NCBI-ProteinID: NP_415170
Pasteur: ybeB
RegulonDB: ECK120001230
ECOCYC: EG11255
ASAP: ABE-0002183
UniProt: P0AAT6
Position
complement(668719..669036)
Genome map
AA seq 105 aa AA seqDB search
MQGKALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSSRHVMSIADHVVQESR
AAGLLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLWS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
ttgcagggtaaagcactccaggattttgttatcgacaaaattgatgacctcaaaggtcag
gacatcatcgccttagacgttcagggcaaatccagcatcaccgactgcatgatcatctgt
acgggtacgtccagccgtcatgttatgtccattgctgaccacgttgtgcaggagtctcgc
gcagcgggcctgttaccgctcggcgtagaaggtgaaaacagcgccgactggattgtcgtg
gatttgggcgatgtgattgtccatgtcatgcaggaagagagccgtcgcctgtatgaactg
gaaaaactctggagttaa

DBGET integrated database retrieval system