KEGG   Escherichia coli K-12 MG1655: b0642Help
Entry
b0642             CDS       T00007                                 

Gene name
leuS
Definition
(RefSeq) leucyl-tRNA synthetase (EC:6.1.1.4)
  KO
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    b0642 (leuS)
Enzymes [BR:eco01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     b0642 (leuS)
Amino acid related enzymes [BR:eco01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   b0642 (leuS)
Transfer RNA biogenesis [BR:eco03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    b0642 (leuS)
 Prokaryotic Type
    b0642 (leuS)
Mitochondrial biogenesis [BR:eco03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    b0642 (leuS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(672201..674783)
Genome map
AA seq 860 aa AA seqDB search
MQEQYRPEEIESKVQLHWDEKRTFEVTEDESKEKYYCLSMLPYPSGRLHMGHVRNYTIGD
VIARYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDNIAYMKNQLKMLGFGYD
WSRELATCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCPNDQTVLANEQVIDGCCWRCD
TKVERKEIPQWFIKITAYADELLNDLDKLDHWPDTVKTMQRNWIGRSEGVEITFNVNDYD
NTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAFIDECRNTKVAEAEMATMEK
KGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVPGHDQRDYEFASKYGLNIKPVI
LAADGSEPDLSQQALTEKGVLFNSGEFNGLDHEAAFNAIADKLTAMGVGERKVNYRLRDW
GVSRQRYWGAPIPMVTLEDGTVMPTPDDQLPVILPEDVVMDGITSPIKADPEWAKTTVNG
MPALRETDTFDTFMESSWYYARYTCPQYKEGMLDSEAANYWLPVDIYIGGIEHAIMHLLY
FRFFHKLMRDAGMVNSDEPAKQLLCQGMVLADAFYYVGENGERNWVSPVDAIVERDEKGR
IVKAKDAAGHELVYTGMSKMSKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQE
SGVEGANRFLKRVWKLVYEHTAKGDVAALNVDALTENQKALRRDVHKTIAKVTDDIGRRQ
TFNTAIAAIMELMNKLAKAPTDGEQDRALMQEALLAVVRMLNPFTPHICFTLWQELKGEG
DIDNAPWPVADEKAMVEDSTLVVVQVNGKVRAKITVPVDATEEQVRERAGQEHLVAKYLD
GVTVRKVIYVPGKLLNLVVG
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagcaataccgcccggaagagatagaatccaaagtacagcttcattgggatgag
aagcgcacatttgaagtaaccgaagacgagagcaaagagaagtattactgcctgtctatg
cttccctatccttctggtcgactacacatgggccacgtacgtaactacaccatcggtgac
gtgatcgcccgctaccagcgtatgctgggcaaaaacgtcctgcagccgatcggctgggac
gcgtttggtctgcctgcggaaggcgcggcggtgaaaaacaacaccgctccggcaccgtgg
acgtacgacaacatcgcgtatatgaaaaaccagctcaaaatgctgggctttggttatgac
tggagccgcgagctggcaacctgtacgccggaatactaccgttgggaacagaaattcttc
accgagctgtataaaaaaggcctggtatataagaagacttctgcggtcaactggtgcccg
aacgaccagaccgtactggcgaacgaacaagttatcgacggctgctgctggcgctgcgat
accaaagttgaacgtaaagagatcccgcagtggtttatcaaaatcactgcttacgctgac
gagctgctcaacgatctggataaactggatcactggccagacaccgttaaaaccatgcag
cgtaactggatcggtcgttccgaaggcgtggagatcaccttcaacgttaacgactatgac
aacacgctgaccgtttacactacccgcccggacacctttatgggttgtacctacctggcg
gtagctgcgggtcatccgctggcgcagaaagcggcggaaaataatcctgaactggcggcc
tttattgacgaatgccgtaacaccaaagttgccgaagctgaaatggcgacgatggagaaa
aaaggcgtcgatactggctttaaagcggttcacccattaacgggcgaagaaattcccgtt
tgggcagcaaacttcgtattgatggagtacggcacgggcgcagttatggcggtaccgggg
cacgaccagcgcgactacgagtttgcctctaaatacggcctgaacatcaaaccggttatc
ctggcagctgacggctctgagccagatctttctcagcaagccctgactgaaaaaggcgtg
ctgttcaactctggcgagttcaacggtcttgaccatgaagcggccttcaacgccatcgcc
gataaactgactgcgatgggcgttggcgagcgtaaagtgaactaccgcctgcgcgactgg
ggtgtttcccgtcagcgttactggggcgcgccgattccgatggtgacgctggaagacggt
accgtaatgccgaccccggacgaccagctgccggtgatcctgccggaagatgtggtaatg
gacggcattaccagcccgattaaagcagatccggagtgggcgaaaactaccgttaacggt
atgccagcactgcgtgaaaccgacactttcgacacctttatggagtcctcctggtactat
gcgcgctacacttgcccgcagtacaaagaaggtatgctggattccgaagcggctaactac
tggctgccggtggatatctacattggtggtattgaacacgccattatgcacctgctctac
ttccgcttcttccacaaactgatgcgtgatgcaggcatggtgaactctgacgaaccagcg
aaacagttgctgtgtcagggtatggtgctggcagatgccttctactatgttggcgaaaac
ggcgaacgtaactgggtttccccggttgatgctatcgttgaacgtgacgagaaaggccgt
atcgtgaaagcgaaagatgcggcaggccatgaactggtttataccggcatgagcaaaatg
tccaagtcgaagaacaacggtatcgacccgcaggtgatggttgaacgttacggcgcggac
accgttcgtctgtttatgatgtttgcttctccggctgatatgactctcgaatggcaggaa
tccggtgtggaaggggctaaccgcttcctgaaacgtgtctggaaactggtttacgagcac
acagcaaaaggtgatgttgcggcactgaacgttgatgcgctgactgaaaatcagaaagcg
ctgcgtcgcgatgtgcataaaacgatcgctaaagtgaccgatgatatcggccgtcgtcag
accttcaacaccgcaattgcggcgattatggagctgatgaacaaactggcgaaagcacca
accgatggcgagcaggatcgcgctctgatgcaggaagcactgctggccgttgtccgtatg
cttaacccgttcaccccgcacatctgcttcacgctgtggcaggaactgaaaggcgaaggc
gatatcgacaacgcgccgtggccggttgctgacgaaaaagcgatggtggaagactccacg
ctggtcgtggtgcaggttaacggtaaagtccgtgccaaaatcaccgttccggtggacgca
acggaagaacaggttcgcgaacgtgctggccaggaacatctggtagcaaaatatcttgat
ggcgttactgtacgtaaagtgatttacgtaccaggtaaactcctcaatctggtcgttggc
taa

DBGET integrated database retrieval system