KEGG   Escherichia coli K-12 MG1655: b0651Help
Entry
b0651             CDS       T00007                                 

Gene name
rihA
Definition
(RefSeq) ribonucleoside hydrolase 1 (EC:3.2.2.-)
  KO
K01250  
pyrimidine-specific ribonucleoside hydrolase [EC:3.2.-.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.-  Glycosylases
    3.2.-.-  
     b0651 (rihA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(683477..684412)
Genome map
AA seq 311 aa AA seqDB search
MALPILLDCDPGHDDAIAIVLALASPELDVKAITSSAGNQTPEKTLRNVLRMLTLLNRTD
IPVAGGAVKPLMRELIIADNVHGESGLDGPALPEPTFAPQNCTAVELMAKTLRESAEPVT
IVSTGPQTNVALLLNSHPELHSKIARIVIMGGAMGLGNWTPAAEFNIYVDPEAAEIVFQS
GIPVVMAGLDVTHKAQIHVEDTERFRAIGNPVSTIVAELLDFFLEYHKDEKWGFVGAPLH
DPCTIAWLLKPELFTSVERWVGVETQGKYTQGMTVVDYYYLTGNKPNATVMVDVDRQGFV
DLLADRLKFYA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcactgccaattctgttagattgcgacccaggtcatgacgacgctatcgcaatagtt
ctcgccctcgcctcaccagagcttgatgtcaaagcaattacgtcttccgccggaaaccag
acaccagaaaaaaccttacgcaatgttctgcgtatgctgaccttgcttaatcgcaccgat
attccggtagcaggcggcgcggtaaaaccgttaatgcgtgagttgattatcgcggacaat
gtgcacggcgaaagcggtctcgacggcccggcattaccggaaccgacattcgcaccgcaa
aactgtacggcggtagagctgatggcgaaaacgctgcgtgaaagtgcggaacctgtcacc
attgtgtctaccggaccgcaaactaacgttgccttgctgctcaatagccatccggaactg
catagcaaaattgcccgtatcgtgattatgggtggcgctatggggctgggtaactggacg
cctgcggctgaatttaatatttacgttgacccggaagcggcagaaattgtcttccagtca
gggatcccggtggtgatggccggtctggatgttactcataaagcacaaatccacgttgaa
gacaccgagcgtttccgcgcgattggtaaccctgtttcaaccattgttgccgaactgctg
gatttcttcctcgaatatcataaagacgaaaaatggggctttgtcggcgcaccactgcat
gacccatgcaccatcgcctggctgttgaaaccggagttatttacctctgttgagcgctgg
gttggcgtggaaacacaggggaaatatacccagggtatgacggttgttgattattattat
ctgacaggcaataaaccgaatgccaccgtaatggtcgatgttgatcgtcagggctttgtt
gatttactggctgatcgtctgaaattttacgcttaa

DBGET integrated database retrieval system