KEGG   Escherichia coli K-12 MG1655: b0652Help
Entry
b0652             CDS       T00007                                 

Gene name
gltL
Definition
(RefSeq) glutamate, aspartate ABC transporter ATP-binding subunit
  KO
K10004  
glutamate/aspartate transport system ATP-binding protein [EC:3.6.3.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Two-component system
Module
Glutamate/aspartate transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0652 (gltL)
  Signal transduction
   02020 Two-component system
    b0652 (gltL)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     b0652 (gltL)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter [MD:M00230] [OT]
    b0652 (gltL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(684530..685255)
Genome map
AA seq 241 aa AA seqDB search
MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPVQQGEITV
DGIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVKVLKRDKAPAREKALKL
LERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEPTSALDPEMINEVLDVMV
ELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDAFFDDPKSDRAKDFLAKIL
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgattaccctgaaaaatgtttcaaaatggtatggtcactttcaggtgctgaccgactgc
tcaaccgaagtgaaaaaaggcgaagtggtggtggtttgcggcccgtctggttccggcaaa
tcaacgctgattaaaaccgtcaacggcctcgaaccggtgcagcaaggtgaaatcaccgtc
gatggtatcgtggttaacgacaagaaaaccgatctggcaaagctgcgttcccgcgtcggg
atggtattccagcatttcgagctgttccctcatctgtcgattatcgaaaacctgaccctg
gcgcaggtgaaagtgcttaaacgcgataaagcgccggctcgtgaaaaagccctgaaactg
ctggagcgtgtcgggctttctgctcacgccaataagtttccggcgcagctttccggcggt
cagcagcagcgtgtggcaatcgctcgcgcgttgtgtatggatcctattgcgatgctgttt
gacgaaccgacatcggcgctggatccggagatgatcaacgaagtactggacgtgatggtg
gaactggcgaacgaaggaatgaccatgatggtggtgacccacgaaatgggctttgcccgt
aaagtggcgaatcgggtgatctttatggacgagggtaaaattgtcgaagactcgccgaaa
gacgctttcttcgatgatccgaaatcggaccgcgcaaaagacttcctcgcgaaaatcctg
cattaa

DBGET integrated database retrieval system