KEGG   Escherichia coli K-12 MG1655: b0654Help
Entry
b0654             CDS       T00007                                 

Gene name
gltJ
Definition
(RefSeq) glutamate/aspartate ABC transporter permease
  KO
K10003  glutamate/aspartate transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
eco02020  Two-component system
Module
eco_M00230  Glutamate/aspartate transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0654 (gltJ)
  Signal transduction
   02020 Two-component system
    b0654 (gltJ)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter [MD:M00230] [OT]
    b0654 (gltJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 945443
NCBI-ProteinID: NP_415187
Pasteur: gltJ
RegulonDB: ECK120002349
ECOCYC: EG12661
ASAP: ABE-0002239
UniProt: P0AER3
Position
complement(685929..686669)
Genome map
AA seq 246 aa AA seqDB search
MSIDWNWGIFLQQAPFGNTTYLGWIWSGFQVTIALSICAWIIAFLVGSFFGILRTVPNRF
LSGLGTLYVELFRNVPLIVQFFTWYLVIPELLPEKIGMWFKAELDPNIQFFLSSMLCLGL
FTAARVCEQVRAAIQSLPRGQKNAALAMGLTLPQAYRYVLLPNAYRVIVPPMTSEMMNLV
KNSAIASTIGLVDMAAQAGKLLDYSAHAWESFTAITLAYVLINAFIMLVMTLVERKVRLP
GNMGGK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagactggaactggggtatttttttacaacaagccccgttcggcaacaccacc
tatcttggttggatctggagtggttttcaggtgacgatcgctttgtcgatctgcgcctgg
attatcgctttcctcgtcggttcatttttcggcattttacgtaccgttccaaaccgtttt
ctctctggtctgggtacgttgtatgtcgaactgttccgcaacgtgccgttgattgtgcaa
ttctttacctggtatctggtgatcccggagctgctgccggagaaaatcggcatgtggttt
aaggccgagctggatcccaatattcagtttttcctttcatccatgctctgcctggggctg
tttaccgccgcccgtgtttgcgaacaggtacgcgccgcgattcagtcgctgccgcgaggg
caaaaaaatgccgcgctggcgatgggcctgacgctaccgcaggcttatcgatacgtactg
ctgcctaatgcttatcgcgttatcgtcccgccgatgacctcagagatgatgaacctggtg
aaaaactccgccatcgcctcgactatcggtctggtggatatggcggcgcaggcgggtaaa
ttgctcgattactcagcccatgcctgggagtcgtttaccgccattacgctggcgtatgtg
ttgattaacgcttttatcatgctggtgatgacgctggttgaacgtaaagttcgcctgcct
ggcaacatggggggcaaataa

DBGET integrated database retrieval system