KEGG   Escherichia coli K-12 MG1655: b0657Help
Entry
b0657             CDS       T00007                                 

Gene name
lnt
Definition
(RefSeq) apolipoprotein N-acyltransferase (EC:2.3.1.-)
  KO
K03820  
apolipoprotein N-acyltransferase [EC:2.3.1.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     b0657 (lnt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(689343..690881)
Genome map
AA seq 512 aa AA seqDB search
MAFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIISLMGLQALTFNRRPLQSAAIG
FCWGFGLFGSGINWVYVSIATFGGMPGPVNIFLVVLLAAYLSLYTGLFAGVLSRLWPKTT
WLRVAIAAPALWQVTEFLRGWVLTGFPWLQFGYSQIDGPLKGLAPIMGVEAINFLLMMVS
GLLALALVKRNWRPLVVAVVLFALPFPLRYIQWFTPQPEKTIQVSMVQGDIPQSLKWDEG
QLLNTLKIYYNATAPLMGKSSLIIWPESAITDLEINQQPFLKALDGELRDKGSSLVTGIV
DARLNKQNRYDTYNTIITLGKGAPYSYESADRYNKNHLVPFGEFVPLESILRPLAPFFDL
PMSSFSRGPYIQPPLSANGIELTAAICYEIILGEQVRDNFRPDTDYLLTISNDAWFGKSI
GPWQHFQMARMRALELARPLLRSTNNGITAVIGPQGEIQAMIPQFTREVLTTNVTPTTGL
TPYARTGNWPLWVLTALFGFAAVLMSLRQRRK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgcctcattaattgaacgccagcgcattcgcctgctgctggcgttattattc
ggtgcctgcggaacgctggccttctctccttacgacgtctggcctgcggcgattatttcg
ctgatggggcttcaggcgttgacctttaaccgccgtccactccagtctgccgctattggc
ttttgctggggatttggcctctttggcagcggtattaactgggtctatgtcagcatcgcg
acctttggcggaatgcctggcccggttaacatcttcctggtggtgctgctggcggcgtat
ttgtcgctgtataccggactgtttgctggcgtgctgtcgcgtctgtggccgaaaaccacc
tggctgcgcgtagcgattgccgcccctgccctctggcaagtgaccgagtttctgcgcggt
tgggtactgaccggcttcccgtggttacagttcggctatagccagattgatggcccgtta
aaagggctggcaccgataatgggcgtggaagccattaacttcctgctgatgatggttagt
ggcctgctggcactggcgttggtcaaacgcaactggcgtccgctggtggtggccgtcgtg
ctgtttgcccttcccttcccgctgcgttacatccagtggtttaccccacaaccggagaaa
accattcaggtttcgatggttcagggcgatattccgcaatcgctgaaatgggacgaaggc
cagcttcttaatacgctgaagatttactacaacgcaacggcaccgctgatgggcaaatca
tcgttgattatctggccggagtcggcgataaccgatctggaaattaatcagcaaccgttc
ctcaaagcactggacggtgagttgcgtgataaaggtagctcgctggtaaccgggattgtc
gacgcgcgtctcaataagcagaaccgctacgatacctacaacaccatcatcacgctgggt
aaaggtgcgccgtacagctacgaatcagccgatcgctataacaaaaaccatctggtgccg
tttggcgagtttgtcccgctggagtcgattctgcgtccgttagcaccgttctttgatctg
ccgatgtcgtcgttcagccgtgggccatatatccagccgccgctgtcggcaaatggtatt
gagcttactgcggctatttgctacgagatcattctcggcgagcaagtgcgcgataacttc
cgcccggataccgactatctgctgactatctccaacgatgcgtggtttggtaaatctatt
ggtccatggcaacacttccagatggcgcgaatgcgtgcgctggagctggcgcgcccactg
ttgcgcagcaccaacaacggcattacggcggtgattggcccgcagggtgagattcaggcg
atgatcccgcagttcacccgcgaggtgttaaccactaacgtgacgccgaccaccggactc
acaccatacgcacgtaccggcaactggccgctgtgggtgctgacggcattgtttggtttt
gctgctgtgttgatgagtctgcgtcagcgacgtaaataa

DBGET integrated database retrieval system